 |
Previous Article | Next Article 
Volume 16, Number 22,
Issue of November 15, 1996
pp. 7137-7150
Copyright ©1996 Society for Neuroscience
Heteromultimerization of G-Protein-Gated Inwardly Rectifying
K+ Channel Proteins GIRK1 and GIRK2 and Their Altered
Expression in weaver Brain
Y. Joyce Liao,
Yuh Nung Jan, and
Lily Yeh Jan
Howard Hughes Medical Institute, Departments of Physiology and
Biochemistry, University of California, San Francisco, San Francisco,
California 94143-0724
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
FOOTNOTES
REFERENCES
ABSTRACT
The weaver (wv) gene (GIRK2) is a
member of the G-protein-gated inwardly rectifying potassium (GIRK)
channel family, known effectors in the signal transduction pathway of
neurotransmitters such as acetylcholine, dopamine, opioid peptides, and
substance P in modulation of neurotransmitter release and neuronal
excitability. GIRK2 immunoreactivity is found in but not limited to
brain regions known to be affected in wv mice, such as
the cerebellar granule cells and dopaminergic neurons in the substantia
nigra pars compacta. It is also observed in the ventral tegmental area,
hippocampus, cerebral cortex, and thalamus. GIRK2 and GIRK1, a related
family member, have overlapping yet distinct distributions in rat and
mouse brains. In regions where both channel proteins are expressed,
such as the cerebral cortex, hippocampus, and cerebellum, they can be
co-immunoprecipitated, indicating that they interact to form
heteromeric channels in vivo. In the brain of the
wv mouse, GIRK2 expression is decreased dramatically. In
regions where GIRK1 and GIRK2 distributions overlap, both GIRK1 and
GIRK2 expressions are severely disrupted, probably because of their
co-assembly. The expression patterns of these GIRK channel subunits
provide a basis for consideration of the machinery for neuronal
signaling as well as the differential effects of the wv
mutation in various neurons.
Key words:
weaver mouse;
G-protein;
inwardly rectifying
potassium channel;
dopamine;
hippocampus;
substantia nigra;
cerebellum;
heteromultimerization;
GIRK
INTRODUCTION
The weaver (wv) mouse
exhibits a diverse range of defects, including ataxia (Sidman et al.,
1965 ; Rakic and Sidman, 1973a ,b; Hatten et al., 1984 ), dopamine
deficiency (Lane et al., 1977 ; Schmidt et al., 1982 ; Roffler-Tarlov and
Graybiel, 1984 ), seizures (Eisenberg and Messer, 1989 ), and
hypospermatogenesis (Vogelweid et al., 1993 ; Harrison and
Roffler-Tarlov, 1994 ). Recently, a G-protein-activated inwardly
rectifying potassium channel (GIRK), Kir3.2
or GIRK2 (Lesage et al., 1994 ; Bond et al., 1995 ; Tsaur et al., 1995 ),
has been identified as the wv gene (Patil et al., 1995 ;
Kofuji et al., 1996 ; Navarro et al., 1996 ; Slesinger et al., 1996 ; for
reviews, see Goldowitz and Smeyne, 1995 ; Hess, 1996 ). GIRK channels are
membrane proteins that conduct K+ currents at or near the
resting membrane potential, and they are important in controlling cell
excitability (Hille, 1992 ; Jan and Jan, 1994 ; Kubo, 1994 ; Doupnik et
al., 1995 ; Wickman and Clapham, 1995a ,b). They are regulated by
G-proteins and have been shown to mediate the actions of
G-protein-coupled receptors for transmitters (Breitwieser and Szabo,
1985 ; Pfaffinger et al., 1985 ; North, 1989 ; Brown, 1990 ; Brown and
Birnbaumer, 1990 ; Nicoll et al., 1990 ). GIRK2 mRNA is found in brain
regions known to be affected by the wv mutation, such as the
cerebellar granule cells and substantia nigra (SN) (Karschin et al.,
1996 ; Kobayashi et al., 1995 ), and both GIRK1 and GIRK2 proteins are
expressed in the cerebellar granule cells and Purkinje cells during
development (Patil et al., 1995 ; Kofuji et al., 1996 ; Navarro et al.,
1996 ; Slesinger et al., 1996 ).
Kir channels are tetramers (Yang et al., 1995 ) and
hence could exist as homo- or heteromeric complexes. In heterologous
expression systems, GIRK1 (Dascal et al., 1993 ; Kubo et al., 1993 ),
unlike GIRK2, does not seem to form functional homomeric channels and
may require either GIRK2 or GIRK4 to form functional channels (Duprat
et al., 1995 ; Kofuji et al., 1995 ; Krapivinsky et al., 1995a ,b; Lesage
et al., 1995 ; Hedin et al., 1996 ). Co-expression of GIRKs 1 and 2 (or 1 and 4) in heterologous systems most likely leads to the formation of
both homomeric GIRK2 (or GIRK4) channels and heteromeric GIRK1/2 (or
1/4) channels (Duprat et al., 1995 ; Kofuji et al., 1995 ; Krapivinsky et
al., 1995a ,b; Lesage et al., 1995 ; Slesinger et al., 1996 ; Spauschus et
al., 1996 ; Velimirovic et al., 1996 ). Interestingly, the wv
mutant form of GIRK2 (G156S) causes the homomeric GIRK2 channels to be
nonselective and conduct sodium as well as potassium ions, whereas the
function of the heteromeric GIRK1/GIRK2 channels is greatly reduced by
the wv mutation (Kofuji et al., 1996 ; Navarro et al., 1996 ;
Slesinger et al., 1996 ; but see Surmeier et al., 1996 ). Thus, the
effects of the wv mutation may vary with the type of GIRK
channel subunits expressed by the neuron.
To study the GIRK channels in vivo, we used Western
blotting, in situ hybridization, and immunohistochemistry to
determine the distribution of GIRK1 and GIRK2 in wild-type rat and
mouse brains. Co-immunoprecipitation of GIRK1 and GIRK2 from wild-type
brain regions and the drastic decrease in expression of both channel
proteins in the wv mouse brain indicate that heteromultimers
of GIRK1 and GIRK2 exist as a major component of GIRK channels in the
mammalian brain.
MATERIALS AND METHODS
In vitro expression of channel proteins. GIRK1,
GIRK2, GIRK4, and IRK1 mRNAs were synthesized in vitro
following manufacturer's instructions (Ambion T7 kit) and injected
into Xenopus oocytes. Oocytes were processed after 2 d
for Western analysis of channel proteins. The oocytes were lysed by
pipetting and washed in 50 mM Tris, pH 7.5, 150 mM NaCl, 1 mM EDTA, and protease inhibitors
(see ``Brain membrane preparation''). Residual membrane was
solubilized in 2% SDS sample buffer (includes 5%
-mercaptoethanol), vortexed with acid-washed glass beads, heated to
75°C for 45 min, and analyzed by Western blotting. The presence of
proteins was shown by recording specific inward rectifier
K+ currents from oocytes or by probing the blots with
channel-specific antibodies. GIRK1, GIRK2, GIRK4, and IRK1 proteins
were also synthesized via in vitro translation in the
presence of rabbit reticulocyte lysate (Promega, Madison, WI) and
analyzed similarly. The presence of proteins was assayed by
35S-methionine incorporation and exposure to
autoradiographic film as well as by probe of the blots with
channel-specific antibodies.
Brain membrane preparation. Adult Sprague Dawley male rats
were anesthetized by brief exposure to halothane (Sigma, St. Louis,
MO), decapitated, and quickly dissected for cerebral cortex,
hippocampus, cerebellum, spinal cord, and liver. For the cortex, care
was taken to remove as much white matter as possible. Tissues were
chopped in ice-cold 0.32 M sucrose, 5 mM Tris,
pH 7.4, 50 µg/ml pA-PMSF, 1 µg/ml leupeptin, 2 µg/ml aprotinin A,
and 1 µg/ml pepstatin (Boehringer Mannheim, Mannheim, Germany), and
dounce-homogenized. Membrane isolation was carried out via differential
centrifugation steps and stored in 80°C as aliquots in 20 mM Tris, pH 7.4, 1 mM EDTA, and protease
inhibitors until use. Protein concentration was assayed using the
Bio-Rad kit (Bio-Rad, Richmond, CA), with BSA as standard.
Antibody production and purification. The peptides for
GIRK1, GIRK2, and IRK1 were synthesized by Dr. C. Turck (Howard Hughes
Medical Institute, University of California, San Francisco). The
peptide sequences are as follows: GIRK1N (residues 6-42)
RKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKC; GIRK1C (residues 346-375)
CHATFEVPTPPYSVKEQEEMLLMSSPLIAPA; GIRK2N (residues 20-51)
DQDVESPVAIHQPKLPKQARDDLPRHISRDRTC (1 and 9 identical, and 2 and 2 conserved amino acids to GIRK3 and GIRK4, respectively); GIRK2C
(residues 403-422) CEKNPEEQTERNGDVANLENE (0 and 3 identical, and 1 and
3 conserved amino acids to GIRK3 and GIRK4, respectively) (based on the
sequence of GIRK2 or GIRK2A; Lesage et al., 1995 ; Tsaur et al., 1995 ).
Peptide coupling and generation of polyclonal antibodies in rabbits
were done by Caltag Corporation (South San Francisco, CA). Antibodies
were affinity-purified with appropriate peptide columns, which were
generated by coupling peptides to Sulfolink coupling gel (Pierce,
Rockford, IL) following the manufacturer's protocol.
Western blotting. Protein samples were prepared in sample
buffer (125 mM Tris, pH 6.8, 20% glycerol, 1-2% SDS, 5%
-mercaptoethanol), heated at 75°C for 30 min, and analyzed by 10%
SDS-PAGE gels. Western blots were blocked with Superblock (Pierce) or
5% nonfat dried milk in TBST buffer (150 mM NaCl, 10 mM Tris, pH 8.0, 0.1% Tween 20) for 10 min or 1 hr,
respectively. Primary antibody (1 µg/ml), primary antibody in the
presence of competitive peptides (10 µg/ml), and secondary antibody
[donkey anti-rabbit antibody (Amersham, Arlington Heights, IL)] were
diluted in 2% normal goat serum and 0.5% BSA in TBST. Blots were
incubated in primary antibodies for 1 hr at room temperature or
overnight at 4°C, washed in TBST, incubated in secondary antibody for
30 min, developed by the ECL method, and exposed briefly to
Hyperfilm-ECL (Amersham).
Immunohistochemistry. The animals used included adult
Sprague Dawley rats (5-6 weeks old) and wv as well as
wild-type C57BL/6 mice. wv mice were purchased from Jackson
Laboratory (Bar Harbor, ME) and bred by N. Patil as well as by Y.J.L.
Mice were genotyped by sequencing tail genomic DNA for the presence of
the G to A mutation. All animals were treated in accordance with the
policy on the use of animals in neuroscience research. Animals were
exposed briefly to halothane (Sigma), injected intraperitoneally with
pentobarbital, and perfused with 4% formaldehyde (Polysciences,
Warrington, PA) and 0.1% glutaraldehyde in PBS. The brain and spinal
cord were dissected and post-fixed for 30 min to overnight. Fifty
micrometer vibratome sections were collected in 0.1 M Tris,
pH 7.6; blocked with 1-3% H2O2, 0.1 M Tris, pH 7.6; washed with 50 mM Tris, 100 mM NaCl, and 50 mM Tris, pH 7.6, 100 mM NaCl, 0.1% Triton X-100; and then blocked in 3-10%
normal goat serum and 0.1-3% BSA. Rabbit polyclonal antibodies were
used at 1 µg/ml. Monoclonal antibodies against calbindin (Sigma),
parvalbumin (Sigma), P65 (courtesy of L. F. Reichardt and I. Fariñas), and tyrosine hydroxylase (TH) (courtesy of L. F. Reichardt and I. Fariñas; Pel-Freeze Biologicals, Rogers, AR)
were used at 1:1000 or 1:5000 dilution. Biotinylated donkey anti-rabbit
or anti-mouse IgG Fab (Jackson Laboratory) were used at 1:200 dilution
as secondary antibodies. Sections were developed with Vectastain ABC
kit (Vector Labs, Burlingame, CA) and diaminobenzidine and mounted in
Permount (Fisher Scientific, Houston, TX). Different brain areas were
identified based on comparison with the rat brain atlas of Paxinos and
Watson (1986) . Antibodies specific for sequences in the N- and
C-terminal domains of the same channel subunit yielded the same
staining patterns, although antibodies against N-terminal sequences in
general gave stronger staining. Little or no staining was detected in
the absence of GIRK1 or GIRK2 antibody, in the presence of preimmune
sera instead of the primary antibodies, or when the primary antibody
was incubated with the antigenic peptide (see Fig. 3C; data
not shown).
Fig. 3.
Higher-magnification views of GIRK1 and GIRK2
staining in rat cerebral cortex, hippocampus, substantia nigra, and
cerebellum. A, GIRK1 immunoreactivity in the barrel
cortex. There is intense staining of layers IV-VI neurons and
neurites. See text for details. I-VI correspond to layers of the
cerebral cortex. B, GIRK2 immunoreactivity in the
hindlimb area of cortex. In the forelimb and hindlimb areas of the
cortex, there is more intense staining of all layers. In particular,
the layer V large pyramidal cells are the most strongly stained cells
in the cortex. C, Negative control for cortex with the
omission of the primary antibody. D, GIRK1
immunoreactivity of the hippocampal formation. The entire molecular
layer, which includes terminal fields of the perforant pathway and
commissural fibers, is strongly stained. Note that the superior blade
of the dentate granule cell is much more stained than the inferior
blade, despite no differences in mRNA level (DePaoli et al., 1994 ;
Karschin et al., 1994 ). There is strong staining of the CA3,
CA2, and CA1 pyramidal cells (CA1 > CA2 = CA3). Stratum lacunosum moleculare
(slm), the terminal field of the perforant pathway, is
strongly stained. Other layers that receive commissural fibers
[stratum radiatum (sr)] and nonhippocampal fibers,
such as those from the thalamus [stratum oriens (so)],
are stained moderately. Stratum lucidum, the terminal field for the
mossy fibers, has relatively little immunoreactivity. E,
GIRK2 immunoreactive pattern in the hippocampus. Strongest staining is
in the CA2 pyramidal cells and CA3 pyramidal
cells closest to CA2. There is light staining of the
CA1 pyramidal cells. The intensity of staining in
slm, sr, and so (in strong to weak
order, slm > so > sr) corresponds to that of the
pyramidal cell layer (CA2 > CA3 > CA1). F, G, GIRK1 and GIRK2 staining,
respectively, in the SN. There is little GIRK1 staining, whereas GIRK2
immunoreactivity can be seen in the cell body and dendrites of the SN
pars compacta (SNc) neurons. H,
Higher-magnification view of a SNc neuron sending dendrite ventrally
into the SN pars reticulata (SNr). GIRK1 (I,
K) and GIRK2 (J, L) immunoreactivity in
the cerebellum is shown. For both GIRK1 and GIRK2, there is strong
staining of the granule cell layer, moderate staining of the deep
cerebellar nuclei, and light staining of the molecular layer. There is
little staining of the Purkinje cells. K, L,
Higher-magnification view of GIRK1 and GIRK2 immunoreactivity of the
cerebellar granule cell layer, respectively. Both GIRK1 and GIRK2
antibodies stain the glomeruli (arrowheads) very
strongly, whereas GIRK1 antibodies also highlight the outline of
granule cells. Scale bars: A-C, 0.2 mm; D,
E, 0.3 mm; F, G, 0.6 mm; H, 0.02 mm; I, J, 0.04 mm; K, L, 0.02 mm.
g, Granule cell layer in the dentate gyrus of the
hippocampus (D, E) or granule cell layer of the
cerebellum (I, J); CA1-3, regions
of hippocampus proper; m, molecular layer of the dentate
gyrus of the hippocampus (D, E) or of the cerebellum
(I, J); p, Purkinje cell layer.
For additional abbreviations, see legend to Figure 2.
[View Larger Version of this Image (125K GIF file)]
In situ hybridization. Antisense and sense
oligonucleotides (45-mers) were designed for the hamster GIRK2 sequence
and end-labeled with -33P-dATP or
-35S-dATP (Amersham). The entire in situ
hybridization protocol was carried out as published (Wisden and Morris,
1994 ). End-labeling with -33P-dATP gave better
signal-to-noise ratio than with -35S-dATP. The antisense
oligonucleotides contained the sequences
gaccaggacgtggaaagcccagtggccattcaccagccaaagttgcct (N terminus),
ctggctaacagggcagagctgcccctgagttggtctgtgtccagc (C terminus), and
gagaagaacccggaagagcagacggagaggaatggtgacgtggc (C terminus control; with
five nucleotides different from the corresponding rat
sequence). Complementary sense oligonucleotides to the above sequences
were also synthesized and used as controls. The C terminus control and
sense oligonucleotide showed background level of signal (data not
shown).
Immunoprecipitation. For immunoprecipitation experiments, an
equal amount of rat brain membranes from cortex, hippocampus, and
cerebellum was lysed in nondenaturing buffer containing 1-2% Triton
X-100, 150-500 mM NaCl, 50 mM Tris, pH 7.4, 1 mM EDTA, and protease inhibitor cocktail (see ``Brain
membrane preparation''). Our previous experience with
immunoprecipitation of voltage-gated K+ channels showed
that this detergent and salt concentration is strong enough to
solubilize rat brain membranes and to prevent nonspecific interactions,
but not strong enough to abolish channel subunit interactions (Sheng et
al., 1993 ). Membranes were also solubilized in 1-2% CHAPS or 60 mM n-octyl glucoside, and preliminary evidence
indicated that use of different detergents did not alter the results of
the immunoprecipitation experiments. The solubilized supernatant was
precleared with some or all of the following items: a nonspecific,
purified rabbit antibody; purified recombinant protein A-sepharose
beads (Pierce); and avidin and biotin beads (Pierce). After
preclearing, the solubilized membrane was incubated first with
antibodies for 2 hr to overnight in 4°C and then with recombinant
protein A-sepharose beads for 2 hr, washed extensively (four to seven
times) in 1 ml of lysis buffer/protease inhibitors, and analyzed on
10% SDS-PAGE and by Western blotting with biotinylated antibodies. No
specific signals were detected when we omitted the primary antibodies
during immunoprecipitation (data not shown).
Because GIRK1 (62 kDa) and GIRK2 (48-50 kDa) are both about the size
of the IgH chain (55 kDa), the strong IgH band obscured the relevant
portion of the blot, thereby rendering interpretation of
immunoprecipitation experiments nearly impossible. Different approaches
to covalently couple purified antibodies to beads either abolished the
ability of the antibodies to immunoprecipitate or failed to
consistently remove all IgH from the blots (data not shown). We
therefore chose to avoid the use of secondary antibodies that would
mark the IgH band. Instead, we biotinylated antibodies against GIRK1 N
or C termini or GIRK2 N terminus after affinity purification and used
streptavidin-HRP for detection. Affinity-purified antibodies were
biotinylated with NHS-LC-Biotin (Pierce) following the manufacturer's
directions and purified using swift desalting columns (Pierce).
Antibodies were washed with PBS and concentrated with Centriprep
columns (Amicon, Beverly, MA).
To ensure that the biotinylated antibodies did not react with IgH
chain, we denatured 1 µg of immunopure rabbit IgG (Pierce) and
analyzed with unlabeled versus biotinylated antibodies (data not
shown). Biotinylated antibodies did not react with denatured IgH and Ig
light chains, but they did give rise to two kinds of undesirable
background bands. On blots probed with biotinylated antibodies, there
were strong 85-120 kDa bands, which could not be competed off with 10 µg competitive peptides (Fig. 4C). The other kind of
background band was a result of the cross-reactivity of the antibodies
with protein A, which ran as 40-50 kDa molecular weight bands. The
presence of this kind of background band was confirmed when whole
protein A-sepharose beads (Pharmacia, Piscataway, NJ) or recombinant
purified protein A-sepharose beads (Pierce) were treated with SDS
sample buffer, analyzed on Western blots, and visualized by different
biotinylated antibodies (data not shown). As a result, a lysis buffer
control (see Fig. 4, BUFFER) was processed in parallel with
all immunoprecipitation experiments to distinguish between authentic
immunoprecipitated proteins and background protein A bands.
Fig. 4.
GIRK1 and GIRK2 are co-immunoprecipitated from rat
cerebral cortex, hippocampus, and cerebellum. A,
Immunoprecipitation and co-immunoprecipitation of GIRK1 and GIRK2 from
membranes of cerebral cortex (CTX), hippocampus
(HP), cerebellum (CB), or buffer control
(BUFFER). Membranes were immunoprecipitated with
different channel antibodies (labeled at top under
IP) and probed with biotinylated antibody against GIRK1
C terminus or GIRK2 N terminus (labeled on the left
under Western). B, Controls for
immunoprecipitation experiments. The antibodies used for
immunoprecipitation are listed above each lane (First
IP). After the first immunoprecipitation, the
``immunodepleted'' supernatants were then subjected to a second
immunoprecipitation (Second IP), and the lanes in the
two blots are matched exactly. G2+pG2,
GIRK1 is not co-immunoprecipitated by GIRK2 antibody in
the presence of competitive GIRK2 peptide. G2+pG1,
GIRK1 is co-immunoprecipitated by GIRK2 antibody in the
presence of noncompetitive GIRK1 peptide. G1+pG1,
GIRK1 is not immunoprecipitated by GIRK1 antibody in the
presence of competitive GIRK1 peptide. G1+pG2,
GIRK1 is immunoprecipitated by GIRK1 antibody in the
presence of noncompetitive GIRK2 peptide. IRK1,
GIRK1 is not co-immunoprecipitated by IRK1 antibody.
Kv1.4, GIRK1 is not co-immunoprecipitated
by Kv1.4 antibody. See Results and Materials
and Methods for details. C, In the presence of
competitive peptide, biotinylated antibody against GIRK2 did not stain
GIRK2 bands, but the background 85 and 120 kDa bands remained.
[View Larger Version of this Image (51K GIF file)]
RESULTS
Western analysis shows that both GIRK1 and GIRK2 are present in
cerebral cortex, hippocampus, and cerebellum
We generated rabbit polyclonal antibodies for analysis of GIRK2
and GIRK1 channel proteins in vivo. To demonstrate antibody
specificity, GIRK2 and GIRK1 antibodies were tested on Western blots
containing GIRK1, GIRK2, GIRK4, and IRK1 proteins synthesized in
vitro. Channel proteins were generated in Xenopus
oocytes injected with cRNA and by in vitro translation in
rabbit reticulocyte lysate. The presence of different channel proteins
was demonstrated by recording specific inwardly rectifying
K+ currents from the oocytes, probing with antibodies
against each channel, or by autoradiography of proteins containing
35S-methionine. Antibody against the N terminus of GIRK2
recognized a specific 48 kDa band in oocytes injected with GIRK2 cRNA
but not in oocytes injected with water or other inwardly rectifying
K+ channel cRNAs (Fig. 1A,
left). Antibody against the N terminus of GIRK1 detected a
55 kDa band in the lane containing GIRK1 protein synthesized in rabbit
reticulocyte lysate in the absence of pancreatic microsomal membrane,
but it did not detect a band in lanes containing GIRK2, GIRK4, or IRK1
proteins (Fig. 1B, left).
Fig. 1.
GIRK1 and GIRK2 are present on membranes from
different rat brain regions. A, B,
Left, Western blots probed with antibody against the N
terminus of GIRK2 or GIRK1, respectively, to demonstrate antibody
specificity. In A, left, Western blot of
GIRK1, GIRK2, GIRK4, and IRK1 proteins expressed in
Xenopus oocytes is probed with antibody against the N
terminus of GIRK2. Control represents oocytes injected with water. In
B, left, Western blot of in
vitro synthesized IRK1, GIRK1, GIRK2, and GIRK4 proteins is
probed with antibody against the N terminus of GIRK1. A,
B, Middle, membranes from rat cerebral
cortex (CTX), hippocampus (HP),
and cerebellum (CB) contain GIRK2 (48 kDa) and GIRK1
(58-60 kDa) proteins, respectively. There are also faint GIRK2 bands
in the spinal cord. See Results for details. A,
B, Right, control Western blots using
antibody against the N terminus of GIRK1 or GIRK2 in the presence of
antigenic peptide. SC, Spinal cord; LIV,
liver.
[View Larger Version of this Image (39K GIF file)]
Affinity-purified rabbit polyclonal antibodies against the N or C
terminus of GIRK2 and GIRK1 were used to identify GIRK2- and
GIRK1-immunoreactive bands in membranes prepared from rat cerebral
cortex and hippocampus as well as from cerebellum. Antibodies against
the N terminus of GIRK2 detected a broad double band of ~48-50 kDa in
cerebral cortex, hippocampus, cerebellum, and spinal cord (Fig.
1A, middle). The size of the
GIRK2-immunoreactive band was consistent with that of the in
vitro translated protein, and the doublet may reflect the presence
of alternatively spliced forms of GIRK2 (Lesage et al., 1994 , 1995 ;
Tsaur et al., 1995 ; Isomoto et al., 1996 ) (N. Patil, unpublished
observation). The 38 kDa band was a cross-reacting protein detected on
Western blots of rat but not mouse brain membranes. Antibody against
the N terminus of GIRK2 preadsorbed with competitive peptide gave rise
to no immunoreactive bands (Fig. 1A,
right). Antibody against the C terminus of GIRK2 could not
detect any immunoreactive bands on Western blots of brain
membranes.
Antibody against the N or C terminus of GIRK1 stained an immunoreactive
band of ~60-62 kDa in cerebral cortex, hippocampus, and cerebellum
(Fig. 1B, middle; data not shown). No
GIRK1 protein was detectable in liver, consistent with the observed
absence of GIRK1 mRNA based on Northern analysis (Kubo et al., 1993 ).
The 35 kDa band was recognized by antibody against the N terminus but
not by antibody against the C terminus of GIRK1. GIRK1 antibodies in
the presence of antigenic peptide could not detect any immunoreactive
bands (Fig. 1B, right).
Immunohistochemistry and in situ hybridization reveal
overlapping yet distinct expression patterns of GIRK1 and GIRK2 channel
subunits in rat
We used antibodies against the N- or C-terminal cytoplasmic
domains of GIRK1 and GIRK2 to study their distribution in rat brain
(for controls, see Materials and Methods). Antibodies against either
the N or the C terminus of the same channel subunit gave rise to
similar immunoreactive patterns. Immunohistochemical studies using
these antibodies revealed that GIRK1 and GIRK2 have overlapping
distribution in some brain regions (Figs. 2,
3, Table 1). Strong
GIRK1 and GIRK2 immunoreactivity was observed in cerebral cortex
(CTX) (Figs. 2A,B, 3A,B,
Table 1), lateral septal nuclei (data not shown), hippocampal formation
(HP) (Figs. 2A,B, 3D,E, Table
1), and cerebellum (Figs. 2D,E, 3I-L),
whereas certain other regions express predominantly GIRK1 or GIRK2.
Strong GIRK1 but low or background level of GIRK2 staining was found in
the caudate-putamen (CP) and globus pallidus (Fig.
2A,B), thalamus (Th) (Fig.
2A,B; for a few exceptions see Table 1 and Fig.
2B), oculomotor nucleus (Table 1), red nucleus (data
not shown), and mesencephalic nuclei of trigeminal nerve (data not
shown). Strong GIRK2 but background level of GIRK1 staining was
observed in the SN (Fig. 3F-H) and ventral tegmental
area (VTA) (data not shown but see Fig. 6A for GIRK2
staining in mouse brain). Low or background level staining for GIRK1
and GIRK2 was found in the hypothalamus, locus coeruleus, and nucleus
basalis of Meynert, regions where electrophysiological studies have
revealed regulation of Kir channels by specific
neurotransmitters (Table 1).
Fig. 2.
Overview of GIRK1 and GIRK2 distribution in the
rat brain. A, D, Parasagittal view of
GIRK1 antibody staining pattern. There is strong staining in the
cerebral cortex (CTX), caudate-putamen
(CP), globus pallidus, thalamus (Th),
hippocampus (HP), and cerebellum (CB) but
not in the substantia nigra (SN) and
hypothalamus. B, E, Parasagittal view of
GIRK2 immunoreactivity. There is strong staining in the CTX, HP, SN,
anterodorsal thalamic nucleus (ad), and CB but not in
many thalamic nuclei, CP, and hypothalamus. C,
Parasagittal view of GIRK2 mRNA distribution. Inset is a
coronal view of GIRK2 mRNA distribution in the ventral midbrain. Signal
can be observed in the HP, CB, SN pars compacta (SNc),
and ventral tegmental area (VTA) but not in corpus
callosum, TH, olfactory bulb (OB), and SN pars
reticulata (SNr). Scale bars: A, B, 1 mm;
C and inset, 2 mm; D, E,
0.8 mm. dcn, Deep cerebellar nuclei; g,
granule cell layer of the cerebellar cortex; m,
molecular layer of the cerebellar cortex; OT, optic
tract.
[View Larger Version of this Image (106K GIF file)]
Table 1.
Protein distribution of GIRK1 and GIRK2 in rat brain and
spinal
corda
|
GIRK1
|
GIRK2
|
|
|
| Signal |
type |
Signal |
type |
|
| Telencephalon |
| Olfactory
bulb |
+ |
|
+ |
a,d |
| Cerebral
cortex |
| Layer I, II, III |
+ |
d,e |
+ |
c |
| Layer
IV |
+++ |
a,d,e |
++ |
c |
| Layer
V |
++ |
a,d |
+++ |
a,b,d |
| Layer
VI |
++ |
a,d |
+ |
a,d |
| Island of
Calleja |
+/ |
|
++ |
a,d |
| Caudate-putamen |
+ |
a,d |
+/ |
d |
| Globus
pallidus |
+ |
a,b,c |
+/ |
c |
| Nucleus basalis of
Meynert |
+/ |
|
+/ |
| Nucleus diagonal
band |
+ |
a,b,c |
| Lateral septal
nucleus |
+++ |
e |
+++ |
e |
| Medial septal
nucleus |
+/ |
|
+/ |
| Dentate gyrus |
| Molecular
layer |
+++ |
d |
++ |
d |
| Granule cells |
| Superior
blade |
++ |
c |
+ |
c |
| Inferior
blade |
+/ |
c |
+ |
c |
| Hilus |
++ |
a,c |
++ |
a,b,c,d |
| Hippocampus |
| CA3 |
| Stratum
oriens |
++ |
c |
++ |
c |
| Stratum
pyramidal |
++ |
a,b,d |
++ |
a,b,d |
| Stratum
radiatum |
++ |
d |
++ |
d |
| Stratum
lucidum |
+/ |
d |
+/ |
d |
| Stratum
lacunosum molecular |
+++ |
d |
+++ |
d |
| CA2 |
| Stratum
oriens |
++ |
c |
++ |
c |
| Stratum
pyramidal |
++ |
a,b,d |
+++ |
a,b,d |
| Stratum
radiatum |
++ |
d |
++ |
d |
| Stratum
lacunosum molecular |
+++ |
d |
+++ |
d |
| CA1 |
| Stratum
oriens |
++ |
d |
+ |
d |
| Stratum
pyramidal |
+++ |
a,c |
+/++ |
a,c |
| Stratum
radiatum |
++ |
d |
+ |
d |
| Stratum
lacunosum molecular |
+++ |
d |
++ |
a,d |
| Subiculum |
+ |
d |
++ |
a,d |
| Presubiculum |
+ |
d |
+/ |
d |
| Parasubiculum |
+ |
d |
+/ |
d |
| Diencephalon |
| Thalamus |
| Paraventricular |
+/ |
d |
| Lateral
dorsal |
+++ |
a,d |
+/ |
d |
| Lateral
posterior |
++ |
d |
+/ |
d |
| Anterior
dorsal |
|
|
++ |
a,d |
| Anterior
medial |
|
|
+/- |
d |
| Medial
dorsal |
+++ |
a,d |
| Ventral
medial |
+ |
a,d |
+ |
a,d |
| Ventral
lateral |
+++ |
a,d |
+ |
a,d |
| Ventral
posterior |
+++ |
a,d |
| Central
medial |
++ |
a,d |
| Central
lateral |
|
|
+ |
a,d |
| Gelatinosus |
++ |
a,d |
| Rhomboid |
+/ |
d |
| Reuniens |
+/ |
d |
| Reticular |
++ |
c |
+ |
c |
| Posterior |
+++ |
a,d |
| Parafascicular |
|
|
+ |
a,d |
| Hypothalamus |
| Anterior
and lateral
anterior |
+/ |
a,d |
+/ |
| Lateral |
+ |
a,b,c,d |
| Dorsal
medial, ventral medial, tuber
cinerium |
+/ |
| Entopeduncular
nucleus |
+/ |
c |
+/ |
| Anterior pretectal
nucleus |
+/ |
| Deep mesencephalic
nucleus |
+/ |
c |
| Mesencephalon |
| Superior
colliculus |
+ |
d |
+ |
d |
| Oculomotor (III)
nucleus |
+++ |
a,d |
+/ |
| Red
nucleus |
+++ |
a,b,c |
+/ |
| Ventral tegmental
area |
+/ |
|
+++ |
a,b,c |
| Substantia
nigra |
| Compacta |
+/ |
|
+++ |
a,b,c |
| Reticulata |
+/ |
|
+++ |
c |
| Inferior
colliculus |
+ |
a,d |
| Metencephalon |
| Postdorsal tegmental
nucleus |
++ |
a,d |
| Lateral dorsal
tegmental nucleus |
+ |
a,b,d |
| Locus
coeruleus |
+/ |
a,d |
+/ |
| Mesencephalic
nucleus trigeminal nerve |
+++ |
a |
+/ |
| Motor,
sensory trigeminal nucleus |
++ |
a,c,d |
| Pontine
reticulata nucleus |
+ |
a,b,c,d |
| Raphe pontine
nucleus |
++ |
| Cerebellum |
| Molecular
layer |
+ |
d |
+ |
d |
| Granule cell layer |
| Granule
cell |
+ |
a |
+/ |
| Glomeruli |
+++ |
|
+++ |
| Purkinje
cells |
+/ |
|
+/ |
| Deep cerebellar
nuclei |
++ |
|
++ |
| Spinal cord |
+/ |
|
a
Signal: staining intensities of +++
strong, ++ moderate, + light, +/ little to background level; type:
staining of a = cell body, b = principal neurite, c = diffuse neurite,
d = diffuse, e = fiber.
|
|
Fig. 6.
Comparison of GIRK1, GIRK2, and IRK1 staining
between wild-type and wv mouse cerebellum. Parasagittal
views of cerebella from wild-type mice and from PND19 wv
mice (inset) counterstained with toluidine blue
(A) or stained with antibodies against GIRK2
(B), GIRK1 (C), and IRK1
(D). There is a dramatic loss of the granule cell layer
(g) and corresponding reduction in the staining
of GIRK2 and GIRK1. The IRK1 staining of Purkinje cell body
(p) and dendrites still persists in the
wv cerebellum. The magnification is the same in each
panel and in the insets. m, Molecular layer. Scale bar,
0.2 mm.
[View Larger Version of this Image (47K GIF file)]
GIRK1 and GIRK2 immunoreactivities were observed mostly in the
somatodendritic subcellular compartment and sometimes in the axon-like
fibers (e.g., lateral septal nucleus), and in some brain regions they
may exist in both compartments (see Table 1 for details). These
observations are consistent with a previous study of GIRK1 protein
distribution (Ponce et al., 1996 ). Both GIRK1 and GIRK2 antibodies
strongly stained cell bodies and dendrites of cells of the hippocampal
formation (Fig. 3D,E). GIRK2 immunoreactivity was prominent
in the cell body and apical dendrite of layer V pyramidal cells in both
the forelimb and hindlimb somatosensory cortex (Fig. 3B) and
in both cell body and dendrites of the dopaminergic neurons in the SN
(Fig. 3G,H). Unlike the predominantly somatodendritic
localization of GIRK1 and GIRK2 immunoreactivities in the above brain
structures, GIRK1 and GIRK2 immunoreactivities in the lateral septal
region seemed to exist in axon-like fibers (data not shown).
In some brain regions, GIRK1 and GIRK2 antibodies seemed to stain
synaptic regions, implying that these channel subunits may exist in
pre- and/or postsynaptic membranes. In the cerebral cortex, GIRK1
immunoreactivity appeared to mark the whisker ``barrels'' in the
primary somatosensory cortex (Fig. 3A). The barrels in layer
IV of the somatosensory cortex are composed of postsynaptic stellate
neurons as well as ascending presynaptic axon terminals from the
ventral posterior thalamus (Waite and Tracey, 1995 ). Because layer IV
of both cerebral cortex and ventral posterior thalamus expresses high
levels of GIRK1 mRNA (DePaoli et al., 1994 ; Karschin et al., 1994 ,
1996 ), GIRK1 protein may be present in pre- and/or postsynaptic
membranes. Both GIRK1 and GIRK2 antibodies strongly stained the
terminal fields of the perforant pathway (part of the trisynaptic
circuit and serial/parallel sensory information processing system) in
the hippocampus (stratum lacunosum moleculare or slm) and
dentate gyrus (outer molecular layer), as well as commissural
projection fields (stratum radiatum or sr) that contain
intrahippocampal connections (Fig. 3D,E, Table 1). The
cerebellar glomeruli, synaptic regions containing granule cell
dendrites and mossy fiber terminals, also exhibited strong GIRK1 and
GIRK2 immunoreactivity (Fig. 3K,L, arrowheads).
Both GIRK1 and GIRK2 staining outlined the border of the glomeruli,
suggesting that the staining may be on the postsynaptic membrane.
This pattern for GIRK1 protein distribution correlated well with the
GIRK1 mRNA distribution determined by in situ hybridization
(DePaoli et al., 1994 ; Karschin et al., 1994 , 1996 ). To test whether
the GIRK2 expression revealed by immunohistochemistry was also
consistent with the GIRK2 mRNA expression pattern, we carried out
in situ hybridization experiments with specific
oligonucleotide probes (for sequence and controls, see Materials and
Methods). Strong GIRK2 mRNA signal was present in SN pars compacta
(SNc, Fig. 2C and inset), VTA (Fig.
2C, inset), hippocampus (HP, Fig.
2C), and cerebellar granule cell layer (g,
Fig. 2C). Light staining can be seen in cerebral cortex
(CTX, Fig. 2C). Low to undetectable signal was
observed in striatum [e.g., caudate-putamen (CP)],
thalamus (Th), hypothalamus, SN pars reticulata
(SNr), and cerebellar Purkinje cell layer. The pattern we
observed is consistent with that of Kobayashi et al. (1995) . Thus, the
overall GIRK2 mRNA distribution confirmed the immunoreactive pattern.
Antibodies against GIRK1 or GIRK2 co-immunoprecipitate GIRK1 and
GIRK2 channel subunits from rat cerebral cortex, hippocampus,
and cerebellum
Antibodies against the N terminus of GIRK1 immunoprecipitated
GIRK1 protein of ~62 kDa from cerebral cortical, hippocampal, and
cerebellar membranes, as revealed by Western analysis using
biotinylated antibodies against GIRK1 C terminus (Fig.
4A) (for an explanation of background
bands and rationale for biotinylating primary antibodies, see Materials
and Methods). Less immunoreactivity was present in hippocampus, and the
band on the Western blot was not evident in the exposure used in Figure
4A. The GIRK2 antibodies also immunoprecipitated
GIRK2 proteins of 48-50 kDa that stained with biotinylated antibodies
against the N terminus of GIRK2 (Fig. 4A). It seemed
that more GIRK1 and GIRK2 were immunoprecipitated from the cerebral
cortex than from the hippocampus or cerebellum.
We found that antibodies against GIRK1 or GIRK2 co-immunoprecipitated
both GIRK1 and GIRK2 channel subunits. When membranes were
immunoprecipitated with GIRK1 antibody but probed for the presence of
GIRK2, we observed co-immunoprecipitation of the 48-50 kDa GIRK2
doublet (Fig. 4A). Conversely, the GIRK1 protein band
was co-immunoprecipitated by GIRK2 antibodies, as indicated by a broad
band of 62 kDa GIRK1 immunoreactivity (Fig. 4A).
Again, the cortex band was the most intense, although GIRK1 and GIRK2
from all three brain regions were co-immunoprecipitated.
To ensure that the immunoprecipitation and co-immunoprecipitation
results were specific, we carried out some control experiments.
The addition of respective antigenic peptides to GIRK1 or GIRK2
antibodies resulted in the absence of immunoprecipitation of the GIRK1
band by GIRK1 antibody (Fig. 4B, G1+pG1)
and no co-immunoprecipitation of the GIRK1 band by the GIRK2 antibody
(G2+pG2) from the cerebral cortex, whereas the addition of
nonantigenic peptides had no effects (Fig. 4B,
G1+pG2 and G2+pG1). Such results were
attributable to the ability of the antigenic peptides to prevent
immunoprecipitation rather than a lack of channel subunits in the
membrane, as shown by a second immunoprecipitation of proteins from the
``immunodepleted'' supernatant after the first immunoprecipitation
(Fig. 4B, Second IP). For example,
although GIRK2 antibody could not co-immunoprecipitate GIRK1 band in
the presence of GIRK2 peptide (Fig. 4B,
G2+pG2), GIRK1 protein could be immunoprecipitated from the
``immunodepleted'' supernatant (Fig. 4B, GIRK1 lane
below the G2+pG2 lane). In the presence of nonantigenic peptide, GIRK2
antibody could co-immunoprecipitate GIRK1 protein (Fig.
4B, G2+pG1), but could not further
co-immunoprecipitate GIRK1 from the ``immunodepleted'' supernatant
(Fig. 4B, GIRK2 lane below the G2+pG1 lane). The same
was true for GIRK1 antibody immunoprecipitation. GIRK1 could not
immunoprecipitate the GIRK1 band in the presence of GIRK1 peptide
(Fig. 4B, G1+pG1); from the (non)
``immunodepleted'' supernatant, GIRK2 antibody could
co-immunoprecipitate the leftover GIRK1 protein (Fig.
4B, GIRK2 lane below the G1+pG1 lane). In the
presence of nonantigenic peptide, GIRK1 antibody could
immunoprecipitate GIRK1 protein (Fig. 4B,
G1+pG2), and no more GIRK1 protein was present in the
immunodepleted supernatant (Fig. 4B, GIRK1 lane below
the G1+pG2 lane).
Using antibodies against the Kir channel IRK1 or a
voltage-gated K+ channel Kv1.4 (Sheng et al.,
1993 ), we were not able to co-immunoprecipitate GIRK1 (Fig.
4B, IRK1 and Kv1.4) or
GIRK2 (data not shown) from the cerebral cortex. The IRK1 and
Kv1.4 antibodies could immunoprecipitate IRK1 and
Kv1.4 channel subunits, respectively, from brain membranes
(data not shown; Sheng et al., 1993 ). Furthermore, we showed that GIRK1
was present in the cortical membrane used for IRK1 and
Kv1.4 immunoprecipitations. In the IRK1-immunodepleted
supernatant, GIRK1 protein could be co-immunoprecipitated by GIRK2
antibody (Fig. 4B, GIRK2 lane below the IRK1 lane),
and in the Kv1.4-immunodepleted supernatant, GIRK1 could be
immunoprecipitated by GIRK1 antibody (Fig. 4B, GIRK1
lane below the Kv1.4 lane). Taken together, these results
indicated that the interaction between GIRK1 and GIRK2 as revealed by
co-immunoprecipitation was specific.
Distribution of GIRK1 and GIRK2 immunoreactivity in mice is similar
to that in rats
By using antibody against the N or C terminus of GIRK1 or GIRK2,
we found GIRK1 and GIRK2 channel proteins in C57BL/6 mice in similar
brain regions, as well as at relative intensities, as those in Sprague
Dawley rats, although some species differences of GIRK2 staining in the
cortex and thalamus were apparent. Although GIRK1 but not GIRK2 was
found in the whisker barrels in the rat, both GIRK1 and GIRK2
immunoreactivity was observed in the whisker barrels in the mouse (data
not shown). In the rat thalamus, GIRK2 is found in a few nuclei (Table
1), whereas in the mouse GIRK2 staining was observed in many thalamic
nuclei (data not shown). We could observe this more broad distribution
of GIRK2 in the mouse when using antibodies against either the N or C
terminus, although the antibody against the C terminus consistently
gave lighter staining (compare Fig. 7B,E with
C,F).
Fig. 7.
Reduction in dendritic and cell body staining of
GIRK2 in the wv SN pars compacta (SNc)
and ventral tegmental area (VTA). Comparison of coronal
sections of wild-type and wv midbrain stained with
antibodies against TH (A, D), N terminus of GIRK2
(B, E), or C terminus of GIRK2 (C,
F). There is a dramatic decrease in both cell number and
dendritic staining of GIRK2-positive neurons in the SNc and
VTA, whereas the number of TH-positive neurons decreases in
the SNc but remains about the same in the VTA.
Scale bar, 0.1 mm.
[View Larger Version of this Image (84K GIF file)]
Decrease in GIRK2 and GIRK1 protein levels in
wv mice
Western blots of membranes prepared from wv and
wild-type littermates showed that the GIRK2 band in wv mice
was less intense than that from wild-type littermates (Fig.
5A). The decrease in the 48 kDa GIRK2 band
was consistent with the decrease in immunostaining (see below). The
58-60 kDa GIRK1 band in wv brain membrane also seemed
slightly less intense than that of the wild-type littermate (Fig.
5B). The additional 55 kDa GIRK1 band in wv brain
may reflect an elevated level of unglycosylated GIRK1 proteins.
Antigenic peptide against either GIRK2 or GIRK1 antibody competed off
all immunoreactive bands.
Fig. 5.
Decreased level of both GIRK2 and GIRK1 proteins
in the wv brain. A, Left,
Western blotting with antibody against GIRK2 shows that there is less
GIRK2 protein in the wv brain than in wild-type brain.
Fifty micrograms of membrane from wild-type littermate or
wv brain were loaded onto each lane. B,
Left, Western blotting with antibody against the N
terminus of GIRK1 demonstrates that there is a slight decrease in the
58-60 kDa GIRK1 band, but there is an additional 55 kDa band, which
may represent an unglycosylated form of GIRK1 in the wv
brain. A, B, Right,
Peptide competition controls for antibodies against the N terminus of
GIRK2 or GIRK1, respectively.
[View Larger Version of this Image (25K GIF file)]
Abnormal GIRK2 expression in cerebellum and SN of the
wv mice
We looked for changes of protein expression in the wv
mouse as a result of the GIRK2 G156S mutation, particularly in the
cerebellum and SN, which are known to exhibit cell death. In the
cerebellum, we used antibodies against GIRK1, GIRK2, IRK1 (found in
Purkinje cell body and dendrites; Y. Joyce Liao, unpublished data),
calbindin (calcium-binding protein found in cerebellar molecular layer
and Purkinje cells; Baimbridge and Miller, 1982 ; McRitchie et al.,
1996 ), and P65 synaptotagmin (found in synapses; Matthew et al., 1981 )
to assess differences between wv mice and wild-type
littermates. At postnatal day (PND) 19 (Fig.
6B,C) and PND27 (data not shown),
antibodies against GIRK2 and GIRK1 gave nearly uniform staining in the
cerebellum of wv mice compared with the discrete staining
patterns in the wild-type littermates. This difference is consistent
with the observation that GIRK1 and GIRK2 are normally expressed in
granule cells (Kobayashi et al., 1995 ; Kofuji et al., 1996 ; Navarro et
al., 1996 ; Slesinger et al., 1996 ), and that most granule cells in
wv mice have disappeared by PND19 (Fig. 6, compare
A with inset). IRK1, calbindin, and P65
synaptotagmin immunoreactivity were observed in both wild-type and
wv mice (Fig. 6D; data not shown),
suggesting that Purkinje cells in wv mice can still
differentiate to some extent. The IRK1-positive Purkinje cell bodies
and dendrites in wv cerebellum were disorganized, and they
filled up the entire cerebellar cortex (Fig. 6D,
inset), consistent with previous observations of Purkinje
cell abnormalities in wv mice (Rakic and Sidman, 1973a ,b;
Smeyene and Goldowitz, 1990).
We examined the SN of wild-type and wv mice for distribution
of GIRK1 (absent in SN; this study), GIRK2, TH (present in SNc and VTA
dopaminergic neuronal cell body and dendrites; Roffler-Tarlov and
Graybiel, 1984 ), Kv1.4 (found in axons in SNr; Sheng et
al., 1992 ), calbindin (found in SNr; Gaspar et al., 1994 ; McRitchie et
al., 1996 ), and P65 synaptotagmin (in synapses; Matthew et al., 1981 ).
At PND19, we found reduced cell number and dendritic staining of
GIRK2-positive cells in the SNc and VTA. With increasing age, we found
even fewer GIRK2-positive cells in SNc and VTA (compare Fig.
7B,C with E,F). The number
of TH-positive cells in the SNc also decreased with age, but there was
no observable difference in the number of TH-positive cells in the VTA
(Fig. 7, compare A and D). We found little
difference in the staining of Kv1.4, calbindin, and P65
synaptotagmin between wv and wild-type SN (data not shown).
The hippocampal formation of wv mice exhibits
abnormal GIRK2 as well as GIRK1 staining
The hippocampi of PND19, PND27, and PND95 wv and
wild-type littermate mice were examined for immunoreactivity with
antibodies against GIRK1, GIRK2, IRK1 (found in cell bodies as well as
dendrites of dentate granule cells and CA3-1 pyramidal cells; Y. Joyce
Liao, unpublished observation), Kv1.4 (found in axons and
axon terminals; Sheng et al., 1992 ), calbindin (calcium-binding protein
in dentate granule cell bodies and dendrites; Baimbridge and Miller,
1982 ), parvalbumin (calcium-binding protein in basket pyramidal
interneurons), and P65 synaptotagmin (in synapses; Matthew et al.,
1981 ). At PND19, there was no dramatic difference between wv
and wild-type hippocampi (data not shown). By PND27 (Fig.
8B,E) and also at PND95 (Fig.
8C,F), significant change in expression of GIRK2 as
well as GIRK1 became apparent. The wv hippocampus no longer
showed intense dendritic staining of GIRK2 in the molecular layer of
the dentate gyrus and strata oriens and radiatum of CA3-1 areas,
although the cell bodies still exhibited light immunoreactivity
comparable with that in the wild-type (compare Fig.
8D with E,F). Interestingly, there
was a similar reduction in GIRK1 immunoreactivity in wv
hippocampi (compare Fig. 8A with B,C). We
observed less prominent differences between wild-type and wv
hippocampi in their staining pattern of IRK1
(Fig.8G-I) and Kv1.4 (data not shown),
two channel subunits that were not found to associate with GIRK1 and
GIRK2 (this paper). There was also relatively little difference in the
staining patterns for calbindin, parvalbumin, and P65 synaptotagmin in
these mice (data not shown). No gross reduction in hippocampal cell
number or size was observed. Thus, the wv mutation appeared
to affect the expression of GIRK1 and GIRK2 specifically.
Fig. 8.
The GIRK2 mutation in wv mice
results in defects not only in GIRK2 but also in GIRK1 expression
patterns in the hippocampus. Serial sections of hippocampi from PND27
wild-type littermate (A, D, G), PND27 wv
(B, E, H), and PND95 wv (C,
F, I) mice for GIRK1 (A-C), GIRK2
(D-F), and IRK1 (G-I)
staining. There is a dramatic decrease in dendritic staining of both
GIRK1 and GIRK2 staining in the wv hippocampi, whereas a
light level of immunoreactivity persists in the cell bodies. There is
relatively little difference in IRK1 staining and in the number of cell
bodies and structure of the hippocampus between wv and
wild-type littermates. See Results for additional details. Scale bar,
0.2 mm.
[View Larger Version of this Image (93K GIF file)]
DISCUSSION
Using antibodies specific for GIRK1 or GIRK2, we have
determined the expression patterns for these two G-protein-gated
Kir channel subunits in mammalian brain and verified that
these patterns of protein expression match the mRNA distributions
(DiPaoli et al., 1994; Karschin et al., 1994 , 1996 ; Kobayashi et al.,
1995 ; this study) and are consistent with the reported GIRK1 protein
distribution (Ponce et al., 1996 ). We show further that GIRK1 and GIRK2
were specifically co-immunoprecipitated from cerebral cortex,
hippocampus, and cerebellum. These findings, together with previous
studies suggesting that GIRK1 and GIRK2 in heterologous systems can
co-assemble to form heteromeric channels (Duprat et al., 1995 ; Kofuji
et al., 1995 , 1996 ; Lesage et al., 1995 ; Navarro et al., 1996 ;
Slesinger et al., 1996 ), indicate that GIRK1/GIRK2 heteromultimeric
channels exist in the mammalian brain. The dramatic alteration in
GIRK1, as well as GIRK2 protein expressions in the wv mice,
suggests that a significant proportion of GIRK1 channel subunit exists
in complex with GIRK2 in the mouse brain.
GIRK channels of different composition exist in different parts of
mammalian brain
GIRK channels may exist in the brain as homomeric channels
composed of one subunit type or as heteromeric complexes of two or more
subunit types. GIRK2 can form functional homo- or heteromeric channels
in heterologous expression systems. It is therefore conceivable that
homomeric GIRK2 channels and heteromeric channels containing GIRK2 may
be found in different proportions in different regions of the brain.
Given that GIRK1 does not seem to form functional homomeric channels in
heterologous systems (Duprat et al., 1995 ; Kofuji et al., 1995 ;
Krapivinsky et al., 1995a ,b; Lesage et al., 1995 ; Hedin et al., 1996 ),
its association with GIRK2 in vivo may form the molecular
basis for some of the GIRK1-containing channels in central neurons.
Because GIRK1 and GIRK2 channel proteins overlap in many brain regions
in the rat and even more so in the mouse, the GIRK1 subunit may be
encountered in heteromeric complexes with GIRK2 in many brain regions.
In regions where GIRK1-4 all seem to be expressed, such as the
hippocampus, cerebral cortex, and thalamus (Karschin et al., 1994 ,
1996 ; Kobayashi et al., 1995 ; Ponce et al., 1996 ; Spauschus et al.,
1996 ; this study), heteromeric GIRK channels may also consist of more
than two different channel subunits, and channels with different
subunit stoichiometry could conceivably exist in the same neuron.
Potential transmitter receptors for in vivo
regulation of Kir channels composed of GIRK1 and/or
GIRK2 subunits
Transmitter receptors that activate Kir
channels via G-proteins include those for acetylcholine
(M2), adenosine (A1), ATP (P2),
dopamine (D2), GABAB, opioid (µ, , ),
serotonin (5-HT1, 5-HT2), norepinephrine
( 2), and somatostatin (North et al., 1987 ; North, 1989 ; Brown, 1990 ;
Nicoll et al., 1990 ; Hille, 1992 , 1994 ; Inoue and Yoshi, 1992 ). Other
receptors such as those for substance P, neurotensin,
thyrotrophin-releasing hormone, and angiotensin II inhibit
Kir channels and cause membrane depolarization (reviews
listed above; Stanfield et al., 1985 ; Yamaguchi et al., 1990 ; Takano et
al., 1995 ). In vitro co-expression experiments have shown
that GIRK channel subunits can form homo- or heteromeric channels that
are activated by neurotransmitter receptors such as M2
acetylcholine receptor (Dascal et al., 1993 ; Kubo et al., 1993 ;
Krapivinsky et al., 1995a ,b; Slesinger et al., 1996 ),
2-adrenergic receptor (Lim et al., 1995 ), opioid
receptor (Dascal et al., 1993 ; Lesage et al., 1994 ), µ opioid
receptor (Chen and Yu, 1994 ; Kovoor et al., 1995 ), opioid receptor
(Henry et al., 1995 ; Ma et al., 1995 ), and 5-HT1A receptor
(Dascal et al., 1993 ; Kovoor et al., 1995 ).
Through the use of electrophysiological and distribution studies,
many neurotransmitter receptors that regulate Kir via
G-proteins have been found in brain regions that also express GIRK1
and/or GIRK2. Although in vitro evidence shows that many
neurotransmitter receptors have the potential to regulate
Kir channels composed of GIRK1-4 subunits, it is not known
just which combination of receptors and GIRK channels mediates the
neurotransmitter effects in different brain regions. We provide here a
brief listing of potential receptors that may regulate Kir
channels containing GIRK1 and/or GIRK2 channel subunits (for review,
see North et al., 1987 ; North, 1989 ; Brown, 1990 ; Nicoll et al., 1990 ;
Inoue et al., 1992; acetylcholine receptor: Levey et al., 1991 ;
Karschin et al., 1994 ; Butcher, 1995 ; adenosine A1 receptor: Weber et
al., 1990 ; Schwabe et al., 1991 ; dopamine D2 receptor:
Mansour et al., 1990 ; opioid receptors: Mansour et al., 1987 ; Meng et
al., 1993 ; Thompson et al., 1993 ; Yasuda et al., 1993 ; Arvidsson et
al., 1995 ; Mestek, 1995; somatostatin receptor: Breder et al.,
1992 ; Gonzalez et al., 1992 ; Karschin et al., 1994 ; Reisine and Bell,
1995 ). In brain regions that express both GIRK1 and GIRK2, the cerebral
cortex expresses the adenosine A1 receptors, receptors for
opioid peptides, and somatostatin receptors. The hippocampus and
dentate gyrus express the A1 receptors, GABAB
receptors, D2 dopamine receptors, 5-HT1A
receptors, µ receptors, and somatostatin receptors. The cerebellar
granule cells express the A1 receptors and somatostatin
receptors (transiently during development). Of regions that express
GIRK2 but only low levels of GIRK1, the A1 adenosine
receptors, 1 and µ opioid receptors, and
D2 dopamine receptors are found in the SNc and VTA. The
present study, combined with previous studies of transmitter receptor
distributions, provides a basis for further characterization of the
molecular composition of Kir channels that are effectors of
various transmitter receptors.
The somatodendritic localization of GIRK1 and GIRK2 channel
subunits in some brain regions suggests that these channels may be
involved in specific functions
The relatively ubiquitous GIRK2 and GIRK1 immunoreactivity and
their regulation by many different transmitter receptors when expressed
in heterologous systems indicate that they are likely to contribute to
a significant fraction of the GIRK channels in vivo. The
presence of mRNA and the somatodendritic localization of GIRK1 and
GIRK2 proteins in certain central neurons (e.g., cerebral cortical
pyramidal cells, SN dopaminergic neurons, and cerebellar granule cells)
suggest that they are on postsynaptic membranes. Many G-protein-coupled
receptors are found in dendrites and cell bodies, where they may
mediate some of the longer lasting effects of transmitters released
from nerve terminals of presynaptic neurons. Similar receptors are also
present in nerve terminals, where they may regulate transmitter
release. In the SN, the D2 autoreceptors in dopaminergic
neurons may regulate the dendritic release of dopamine, a
neurotransmitter believed to be important for the self-regulation of
dopaminergic neurons (Cheramy et al., 1981 ). Because GIRK2 is highly
expressed in the SNc (Figs. 3G,H, 7B,C) but in
low or background level in the striatum (Fig. 2B), it
seems more likely that GIRK2 is involved in controlling dendritic
dopamine release than in controlling release from nigral dopaminergic
axon terminals. In many other regions of the brain, GIRK1 and GIRK2 are
localized to sites of synapses, such as the glomeruli of the cerebellar
granule cell layer (Fig. 3K,L), perforant pathway
terminal fields in the hippocampal formation (Figs. 3D,E,
8A,D), and layer IV of the barrel cortex (Fig.
3A). To elucidate the function of the GIRK channel subunits
in these regions, it will be important to use electron microscopy to
determine their pre- and/or postsynaptic localization and to identify
transmitter receptors that may regulate them in vivo.
Recently, Ponce et al. (1996) showed by electron microscopy that GIRK1
is found in the postsynaptic membrane of the granule cell dendrites,
and they also showed that GIRK1 may be present presynaptically in the
thalamic projections to the layer IV of the cerebral cortex and stratum
lacunosum moleculare of the hippocampus.
Downregulation of GIRK1 as well as GIRK2 protein expression and
distribution in the wv mice may be a result of their
association in vivo
It is surprising that the wv mutation, a single
nucleotide change, could have resulted in the decrease in protein level
as well as the dramatic alteration in protein distribution of both
GIRK1 and GIRK2 channel subunits. Given that GIRK1 and GIRK2 interact
in vivo to form heteromeric complexes, the simplest
explanation for the downregulation of both proteins is the removal of
GIRK1/GIRK2 channel complexes that contain abnormal GIRK2wv
protein. Central neurons may target the GIRK1/GIRK2wv
channel complex for degradation attributable to either abnormal
structure or function. The selective removal of aberrant channel
complexes may take place soon after protein synthesis in the
endoplasmic reticulum or at the level of protein targeting. Some of the
downregulation of expression may also take place after the aberrant
GIRK1/GIRK2wv complex has reached the plasma membrane, where
its abnormal electrophysiological properties would be evident. Because
abnormal current as a result of the wv mutation can be
recorded from the cell body of dissociated cerebellar granule cells
(Kofuji et al., 1996 ; Surmeier et al., 1996 ) (P. A. Slesinger,
unpublished observation), some GIRK channel complex containing the
GIRK2wv subunit is clearly inserted into the plasma membrane
of the cell body. Because more of the unglycosylated form of GIRK1 can
be found in the wv mice, it seems likely that some of the
GIRK1/GIRK2wv complex is being retained in the endoplasmic
reticulum.
Mutation in GIRK2 may directly or indirectly give rise to
cerebellar and dopaminergic dysfunctions in wv mice
The G156S mutation in GIRK2 causes a range of abnormalities of
channels expressed in Xenopus oocytes, including loss of
potassium selectivity of GIRK2 channels and reduction of function of
heteromultimers of GIRK1 and GIRK2 (Kofuji et al., 1996 ; Navarro et
al., 1996 ; Slesinger et al., 1996 ). It thus appears that the
wv mutation could qualitatively exert different effects in
different neurons, depending on the level of expression of GIRK2 and
other Kir channel subunits such as GIRK1. In neurons that
express high levels of GIRK2 but not GIRK1, such as the dopaminergic
neurons in the SN, the wv mutation could lead to chronic or
inhibitory transmitter-induced depolarization and potentially to cell
death. In other neurons that normally produce heteromeric channels
containing GIRK1 and GIRK2 subunits, such as those in the cerebral
cortex, hippocampus, thalamus, and cerebellum, this mutation may weaken
or abolish certain signaling processes. It seems likely that cerebellar
granule cells could belong to this latter category. Although no
dramatic anatomical defects in hippocampus, cerebral cortex, and
thalamus have been reported (but see Sekiguchi et al., 1995 ), we find
that the subcellular distribution of both GIRK1 and GIRK2 channel
subunits in these brain regions is severely altered in the
wv mice. It is possible that neurons in these brain regions
have compensatory mechanisms that prevent them from dying, unlike the
cerebellar granule cells and SN dopaminergic neurons. These mechanisms
may facilitate the removal of free calcium from the cytoplasm, removal
of mutant channel complexes from the plasma membrane, or substitution
of GIRK2 functions with other GIRK channel subunits. To understand the
roles of G-protein-gated Kir channels in vivo
and in the different wv mutant phenotypes, it would be
important to determine the channel compositions and transmitter
receptors that regulate these channels in different cell types during
development and in the adult.
FOOTNOTES
Received Aug. 13, 1996; accepted Aug. 22, 1996.
This research was supported by a grant from the National Institute of
Mental Health to the Silvio Conte Neuroscience Center at the University
of California, San Francisco (UCSF), the UCSF Neuroscience Graduate
Program, and the Medical Scientist Training Program. Y.N.J. and L.Y.J.
are Howard Hughes Medical Institute investigators. We thank A. Collins
and P. A. Slesinger for oocyte injections, J. Yu for technical
assistance, E. Reuveny for providing cRNA, N. Patil for providing
weaver mice, L. Reichardt and Isabel Fariñas for
P65 and TH antibodies, L. Ackerman and William Walantus for assistance
with photography, and A. Basbaum for instructions on spinal cord
dissection. We also thank C. Bargmann, D. Bredt, S. Gompert, T. Hensch,
T. Hwang, P. Slesinger, and M. Vetter for insightful discussions and
critical comments on an earlier draft of this manuscript.
Correspondence should be addressed to Lily Yeh Jan, Howard Hughes
Medical Institute, University of California, San Francisco, San
Francisco, CA 94143-0724.
REFERENCES
-
Arvidsson U,
Riedl M,
Chakrabarti S,
Lee J-H,
Nakano AH,
Dado RJ,
Loh HH,
Law P-Y,
Wessendorf MW,
Elde R
(1995)
Distribution and targeting of a µ-opioid receptor (MOR1) in brain and spinal cord.
J Neurosci
15:3328-3341 .
[Abstract]
-
Baimbridge KG,
Miller JJ
(1982)
Immunohistochemical localization of calcium-binding protein in the cerebellum, hippocampal formation and olfactory bulb of the rat.
Brain Res
245:223-229 .
[Web of Science][Medline]
-
Bond CT,
Ammala C,
Ashfield R,
Blair TA,
Gribble F,
Khan RN,
Lee K,
Proks P,
Rowe ICM,
Sakura H,
Ashford MJ,
Adelman JP,
Ashcroft FM
(1995)
Cloning and functional expression of the cDNA encoding an inwardly-rectifying potassium channel expressed in pancreatic
-cells and in the brain.
FEBS Lett
367:61-66 .
[Web of Science][Medline]
-
Breder CD,
Yamada Y,
Yasuda K,
Seino S,
Saper CB,
Bell GI
(1992)
Differential expression of somatostatin receptor subtypes in brain.
J Neurosci
12:3920-3934 .
[Abstract]
-
Breitwieser GE,
Szabo G
(1985)
Uncoupling of cardiac muscarinic and
-adrenergic receptors from ion channels by a guanine nucleotide analogue.
Nature
317:538-540 .
[Medline]
-
Brown D
(1990)
G-proteins and potassium currents in neurons.
Annu Rev Physiol
52:215-242 .
[Web of Science][Medline]
-
Brown AM,
Birnbaumer L
(1990)
Ionic channels and their regulation by G protein subunits.
Annu Rev Physiol
52:197-213 .
[Web of Science][Medline]
-
Butcher LL
(1995)
Cholinergic neurons and networks.
In: The rat nervous system
(Paxinos, G,
eds)
, p. 1003. San Diego, CA: Academic.
-
Chen Y,
Yu L
(1994)
Differential regulation by cAMP-dependent protein kinase and protein kinase C of the µ-opioid receptor coupling to a G protein-activated K+ channel.
J Biol Chem
269:7839-7842 .
[Abstract/Free Full Text]
-
Cheramy A,
Leviel V,
Glowinski J
(1981)
Dendritic release of dopamine in the substantia nigra.
Nature
289:537-542 .
[Medline]
-
Dascal N,
Schreibmayer W,
Lim NF,
Wang W,
Chavkin C,
DiMagno L,
Labarca C,
Kieffer BL,
Gaveriaux-Ruff C,
Trollinger D,
Lester HA,
Davidson N
(1993)
Atrial G-protein-activated K+ channel: expression cloning and molecular properties.
Proc Natl Acad Sci USA
90:10235-10239 .
[Abstract/Free Full Text]
-
DePaoli AM,
Bell GI,
Stoffel M
(1994)
G protein-activated inwardly rectifying potassium channel (GIRK1/KGA) mRNA in adult rat heart and brain by in situ hybridization histochemistry.
Mol Cell Neurosci
5:515-522 .
[Web of Science][Medline]
-
Doupnik CA,
Davidson N,
Lester HA
(1995)
The inward rectifier potassium channel family.
Curr Opin Neurobiol
5:268-277 .
[Web of Science][Medline]
-
Duprat F,
Lesage F,
Guillemare E,
Fink M,
Hugnot J-P,
Bigay J,
Lazdunski M,
Romey G,
Barhanin J
(1995)
Heterologous multimeric assembly is essential for K+ channel activity of neuronal and cardiac G-protein-activated inward rectifiers.
Biochem Biophys Res Commun
212:657-663 .
[Web of Science][Medline]
-
Eisenberg B,
Messer A
(1989)
Tonic/clonic seizures in a mouse mutant carrying the weaver gene.
Neurosci Lett
96:168-172 .
[Web of Science][Medline]
-
Gaspar P,
Ben Jelloun N,
Febvret A
(1994)
Sparing of the dopaminergic neurons containing calbindin-D28K and of the dopaminergic mesocortical projections in weaver mutant mice.
Neuroscience
61:293-305 .
[Web of Science][Medline]
-
Goldowitz D,
Smeyne RJ
(1995)
Tune into the weaver channel.
Nature Genet
11:107-109 .
[Web of Science][Medline]
-
Gonzalez B,
Leroux P,
Lamacz M,
Bodenant C,
Balazs R,
Vaudry H
(1992)
Somatostatin receptors are expressed by immature cerebellar granule cells: evidence for a direct inhibitory effect of somatostatin on neuroblast activity.
Proc Natl Acad Sci USA
89:9627-9631 .
[Abstract/Free Full Text]
-
Harrison SMW,
Roffler-Tarlov S
(1994)
Male-sterile phenotype of the neurological mouse mutant weaver.
Dev Dynamics
200:26-38.
[Web of Science][Medline]
-
Hatten ME,
Liem RK,
Mason CA
(1984)
Defects in specific associations between astroglia and neurons occur in microcultures of weaver mouse cerebellar cells.
J Neurosci
4:1163-1172 .
[Abstract]
-
Hedin KE,
Lim NF,
Clapham DE
(1996)
Cloning of a Xenopus laevis inwardly rectifying K+ channel subunit that permits GIRK1 expression of IKACh currents in oocytes.
Neuron
16:423-429 .
[Web of Science][Medline]
-
Henry DJ,
Grandy DK,
Lester HA,
Davidson N,
Chavkin C
(1995)
-opioid receptors couple to inwardly rectifying potassium channels when co-expressed by Xenopus oocytes.
Mol Pharmacol
47:551-557 .
[Abstract]
-
Hess EJ
(1996)
Identification of the weaver mouse mutation: the end of the beginning.
Neuron
16:1073-1076 .
[Web of Science][Medline]
-
Hille B
(1992)
In: Ionic channels of excitable membranes, 2nd ed.
. Sunderland, MA: Sinauer.
-
Hille B
(1994)
Modulation of ion-channel function by G-protein-coupled receptors.
Trends Neurosci
17:409-442.
-
Inoue M,
Yoshi M
(1992)
Modulation of ion channels by somatostatin and acetylcholine.
Prog Neurobiol
38:203-230 .
[Web of Science][Medline]
-
Isomoto S,
Kondo C,
Takahashi N,
Matsumoto S,
Yamada M,
Takumi T,
Horio Y,
Kurachi Y
(1996)
A novel ubiquitously distributed isoform of GIRK2 (GIRK2B) enhances GIRK1 expression of the G-protein-gated K+ current in Xenopus oocytes.
Biochem Biophys Res Commun
218:286-291 .
[Web of Science][Medline]
-
Jan LY,
Jan YN
(1994)
Potassium channels and their evolving gates.
Nature
371:119-122 .
[Medline]
-
Karschin C,
Schrebmayer W,
Dascal N,
Lester H,
Davidson N,
Karschin A
(1994)
Distribution and localization of a G protein-coupled inwardly rectifying K+ channel in the rat.
FEBS Lett
348:139-144 .
[Web of Science][Medline]
-
Karschin C,
Dißmann E,
Stühmer W,
Karschin A
(1996)
IRK(1-3) and GIRK(1-4) inwardly rectifying K+ channel mRNAs are differentially expressed in the adult rat brain.
J Neurosci
16:3559-3570 .
[Abstract/Free Full Text]
-
Kobayashi T,
Ikeda K,
Ichikawa T,
Abe S,
Togashi S,
Kumanishi T
(1995)
Molecular cloning of a mouse G-protein-activated K+ channel (mGIRK1) and distinct distributions of three GIRK (GIRK1, 2 and 3) mRNAs in mouse brain.
Biochem Biophys Res Commun
208:1166-1173 .
[Web of Science][Medline]
-
Kofuji P,
Davidson N,
Lester HA
(1995)
Evidence that neuronal G-protein-gated inwardly rectifying K+ channels are activated by G
 subunits and function as heteromultimers.
Proc Natl Acad Sci USA
92:6542-6546 .
[Abstract/Free Full Text]
-
Kofuji P,
Hofer M,
Millen KJ,
Millonig JH,
Davidson Lester HA,
Hatten ME
(1996)
Functional analysis of the weaver mutant GIRK2 K+ channel and rescue of weaver granule cells.
Neuron
16:941-952 .
[Web of Science][Medline]
-
Kovoor A,
Henry DJ,
Chavkin C
(1995)
Agonist-induced desensitization of the mu opioid receptor-coupled potassium channel (GIRK1).
J Biol Chem
270:589-595 .
[Abstract/Free Full Text]
-
Krapivinsky G,
Gordon EA,
Wickman K,
Velimirovic B,
Krapivinsky L,
Clapham DE
(1995a)
The G-protein-gated atrial K+ channel IKACh is a heteromultimer of two inwardly rectifying K+-channel proteins.
Nature
374:135-141 .
[Medline]
-
Krapivinsky G,
Krapivinsky L,
Velimirovic B,
Wickman K,
Navarro B,
Clapham DE
(1995b)
The cardiac inward rectifier K+ channel subunit, CIR, does not comprise the ATP-sensitive K+ channel, IKATP.
J Biol Chem
270:28777-28779 .
[Abstract/Free Full Text]
-
Kubo Y
(1994)
Towards the elucidation of the structural-functional relationship of inward rectifying K+ channel family.
Neurosci Res
21:109-117 .
[Web of Science][Medline]
-
Kubo Y,
Reuveny E,
Slesinger PA,
Jan YN,
Jan LY
(1993)
Primary structure and functional expression of a rat G-protein-coupled muscarinic potassium channel.
Nature
364:802-806 .
[Medline]
-
Lane JD,
Nadi NS,
McBride WJ,
Aprison MH,
Kusano K
(1977)
Contents of serotonin, norepinephrine and dopamine in the cerebrum of the ``staggerer,'' ``weaver'' and ``nervous'' neurologically mutant mice.
J Neurochem
29:349-350 .
[Web of Science][Medline]
-
Lesage F,
Duprat F,
Fink M,
Guillemare E,
Coppola T,
Lazdunski M,
Hugnot J-P
(1994)
Cloning provides evidence for a family of inward rectifier and G-protein coupled K+ channels in the brain.
FEBS Lett
353:37-42 .
[Web of Science][Medline]
-
Lesage F,
Guillemare E,
Fink M,
Duprat F,
Heurteaux C,
Fosset M,
Romey G,
Barhanin J,
Lazdunski M
(1995)
Molecular properties of neuronal G-protein-activated inwardly rectifying K+ channels.
J Biol Chem
270:28660-28667 .
[Abstract/Free Full Text]
-
Levey AI,
Kitt CA,
Simonds WF,
Price DL,
Brann MR
(1991)
Identification and localization of muscarinic acetylcholine receptor proteins in brain with subtype-specific antibodies.
J Neurosci
11:3218-3226 .
[Abstract]
-
Lim NF,
Dascal N,
Labarca C,
Davidson N,
Lester HA
(1995)
A G protein-gated K channel is activated via
2-adrenergic receptors and G subunits in Xenopus oocytes.
J Gen Physiol
105:421-439 .
[Abstract/Free Full Text]
-
Ma GH,
Miller RJ,
Kuznetsov A,
Philipson LH
(1995)
-Opioid receptor activates an inwardly rectifying K+ channel by a G protein-linked mechanism: coexpression in Xenopus oocytes.
Mol Pharmacol
47:1035-1040 .
[Abstract]
-
Mansour A,
Khachaturian H,
Lewis ME,
Akil H,
Watson SJ
(1987)
Autoradiographic differentiation of mu, delta, and kappa opioid receptors in the rat forebrain and midbrain.
J Neurosci
7:2445-2464 .
[Abstract]
-
Mansour A,
Meador-Woodruff JH,
Bunzow JR,
Civelli O,
Akil H,
Watson SJ
(1990)
Localization of dopamine D2 receptor mRNA and D1 and D2 receptor binding in the rat brain and pituitary: an in situ hybridization-receptor autoradiographic analysis.
J Neurosci
10:2587-2600 .
[Abstract]
-
Matthew W,
Tsavaler L,
Reichardt LF
(1981)
Identification of a synaptic vesicle specific membrane protein with a wide distribution in neuronal and neurosecretory tissue.
J Cell Biol
91:257-269 .
[Abstract/Free Full Text]
-
McRitchie DA,
Hardman CD,
Halliday GM
(1996)
Cytoarchitectural distribution of calcium binding proteins in midbrain dopaminergic regions of rats and humans.
J Comp Neurol
364:121-150 .
[Web of Science][Medline]
-
Meng F,
Xie G-X,
Thompson RC,
Mansour A,
Goldstein A,
Watson SJ,
Akil H
(1993)
Cloning and pharmacological characterization of a rat
opioid receptor.
Proc Natl Acad Sci USA
90:9954-9958 .
[Abstract/Free Full Text]
-
Mestek A,
Hurley JH,
Bye LS,
Campbell AD,
Chen Y,
Tian M,
Liu J,
Schulman H,
Yu L
(1995)
The human µ opioid receptor: modulation of functional desensitization by calcium/calmodulin-dependent protein kinase and protein kinase C.
J Neurosci
15:2396-2406 .
[Abstract]
-
Navarro B,
Kennedy ME,
Velimirovic B,
Bhat D,
Peterson AS,
Clapham DE
(1996)
Nonselective and G
 -insensitive weaver K+ channels.
Science
272:1950-1953 .
[Abstract]
-
Nicoll RA,
Malenka RC,
Kauer JA
(1990)
Functional comparison of neurotransmitter receptor subtypes in mammalian central nervous system.
Physiol Rev
70:513-565 .
[Free Full Text]
-
North A
(1989)
Drug receptors and the inhibition of nerve cells.
Br J Pharmacol
98:13-28.
[Web of Science][Medline]
-
North RA,
Williams JT,
Surprenant A,
Christie MJ
(1987)
µ and
receptors belong to a family of receptors that are coupled to potassium channels.
Proc Natl Acad Sci USA
84:5487-5491 .
[Abstract/Free Full Text]
-
Patil N,
Cox DR,
Bhat D,
Faham M,
Myers RM,
Peterson AS
(1995)
A potassium channel mutation in weaver mice implicates membrane excitability in granule cell differentiation.
Nature Genet
11:126-129 .
[Web of Science][Medline]
-
Paxinos G,
Watson C
(1986)
In: The rat brain in stereotaxic coordinates, 2nd ed.
. San Diego: Academic.
-
Pfaffinger PJ,
Martin JM,
Hunter DD,
Nathanson NM,
Hille B
(1985)
GTP-binding proteins couple cardiac muscarinic receptors to a K+ channel.
Nature
317:536-538 .
[Medline]
-
Ponce A,
Bueno E,
Kentros C,
Vega-Saenz de Miera E,
Chow A,
Hillman D,
Chen S,
Zhu L,
Wu MB,
Wu X,
Rudy B,
Thornhill WB
(1996)
G-protein-gated inward rectifier K+ channel proteins (GIRK1) are present in the soma and dendrites as well as in nerve terminals of specific neurons in the brain.
J Neurosci
16:1990-2001 .
[Abstract/Free Full Text]
-
Rakic P,
Sidman RL
(1973a)
Sequence of developmental abnormalities leading to granule cell deficit in cerebellar cortex of weaver mutant mice.
J Comp Neurol
152:103-132 .
[Web of Science][Medline]
-
Rakic P,
Sidman RL
(1973b)
Organization of cerebellar cortex secondary to deficit of granule cells in weaver mutant mice.
J Comp Neurol
152:133-162 .
[Web of Science][Medline]
-
Reisine T,
Bell G
(1995)
Molecular properties of somatostatin receptors.
Neuroscience
67:777-790 .
[Web of Science][Medline]
-
Roffler-Tarlov S,
Graybiel AM
(1984)
weaver mutation has differential effects on the dopamine-containing innervation of the limbic and nonlimbic striatum.
Nature
307:62-66 .
[Medline]
-
Schmidt MJ,
Sawyer BD,
Perry KW,
Fuller RW,
Foreman MM,
Ghetti B
(1982)
Dopamine deficiency in the weaver mutant mouse.
J Neurosci
2:376-380 .
[Abstract]
-
Schwabe U,
Lorenzen A,
Grun S
(1991)
Adenosine receptors in the central nervous system.
J Neurotransm [Suppl]
34:149-155.
-
Sekiguchi M,
Nowakowski RS,
Nagato Y,
Tanaka O,
Guo H,
Madoka M,
Abe H
(1995)
Morphological abnormalities in the hippocampus of the weaver mutant mouse.
Brain Res
696:262-267 .
[Web of Science][Medline]
-
Sheng M,
Tsaur M-L,
Jan YN,
Jan LY
(1992)
Subcellular segregation of two A-type K+ channel proteins in rat central neurons.
Neuron
9:271-284 .
[Web of Science][Medline]
-
Sheng M,
Liao YJ,
Jan YN,
Jan LY
(1993)
Presynaptic A-current based on heteromultimeric K+ channels detected in vivo.
Nature
365:72-75 .
[Medline]
-
Sidman R,
Green M,
Appel S
(1965)
In: Catalogue of neurological mutants of the mouse.
. Cambridge, MA: HarvardUP.
-
Slesinger PA,
Patil N,
Liao YJ,
Jan YN,
Jan LY,
Cox DR
(1996)
Functional effects of the mouse weaver mutation on G protein-gated inwardly rectifying K+ channels.
Neuron
16:321-331 .
[Web of Science][Medline]
-
Smeyne RJ,
Goldowitz D
(1990)
Purkinje cell loss is due to a direct action of the weaver gene in Purkinje cells: evidence from chimeric mice.
Dev Brain Res
52:211-218 .
[Medline]
-
Spauschus A,
Lentes K-U,
Wischmeyer E,
Dibmann E,
Karschin C,
Karschin A
(1996)
A G-protein-activated inwardly rectifying K+ channel (GIRK4) from human hippocampus associates with other GIRK channels.
J Neurosci
16:930-938 .
[Abstract/Free Full Text]
-
Stanfield PR,
Nakajima Y,
Yamaguchi K
(1985)
Substance P raises neuronal membrane excitability by reducing inward rectification.
Nature
315:498-501 .
[Medline]
-
Surmeier DJ, Mermelstein PG, Goldowitz D (1996) The
weaver mutation of GIRK2 results in a loss of inwardly
rectifying K+ current in cerebellar granule cells. Proc
Natl Acad Sci USA, in press.
-
Takano K,
Stanfield PR,
Nakajima S,
Nakajima Y
(1995)
Protein kinase C-mediated inhibition of an inward rectifier potassium channel by substance P in nucleus basalis neurons.
Neuron
14:999-1008 .
[Web of Science][Medline]
-
Thompson RC,
Mansour A,
Akil H,
Watson SJ
(1993)
Cloning and pharmacological characterization of a rat µ opioid receptor.
Neuron
11:903-913 .
[Web of Science][Medline]
-
Tsaur M-L,
Menzel S,
Lai F-P,
Espinosa III,
R,
Concannon P,
Spielman RS,
Hanis CL,
Cox NJ,
Le Beau MM,
German MS,
Jan LY,
Bell GI,
Stoffel M
(1995)
Isolation of a cDNA clone encoding a KATP channel-like protein expressed in insulin-secreting cells, localization of the human gene to chromosome band 21q22.1, and linkage studies with NIDDM.
Diabetes
44:592-596 .
[Abstract]
-
Velimirovic BM,
Gordon EA,
Lim NF,
Navarro B,
Clapham DE
(1996)
The K+ channel inward rectifier subunits form a channel similar to neuronal G protein-gated K+ channel.
FEBS Lett
379:31-37 .
[Web of Science][Medline]
-
Vogelweid CM,
Verina T,
Norton J,
Harruff R,
Ghetti B
(1993)
Hypospermatogenesis is the cause of infertility in the male weaver mutant mouse.
J Neurogenet
9:89-104 .
[Web of Science][Medline]
-
Waite PME,
Tracey DJ
(1995)
Trigeminal sensory system.
In: The rat nervous system
(Paxinos, G,
eds)
, p. 705. San Diego: Academic.
-
Weber R,
Jones CR,
Lohse MJ,
Palacios JM
(1990)
Autoradiographic visualization of A1 adenosine receptors in rat brain with [H3]H-cyclopentyl-1,3-dipropylxanthine.
J Neurochem
54:1344-1353 .
[Web of Science][Medline]
-
Wickman K,
Clapham DE
(1995a)
Ion channel regulation by G proteins.
Physiol Rev
75:865-885 .
[Abstract/Free Full Text]
-
Wickman K,
Clapham DE
(1995b)
G-protein regulation of ion channels.
Curr Opin Neurobiol
5:278-285 .
[Web of Science][Medline]
-
Wisden W,
Morris BJ
(1994)
In situ hybridization with synthetic oligonucleotide probes.
In: In situ hybridization protocols for the brain
(Wisden, W,
Morris, BJ,
eds)
, p. 9. San Diego: Academic.
-
Yamaguchi K,
Nakajima Y,
Nakajima S,
Stanfield PR
(1990)
Modulation of inwardly rectifying channels by substance P in cholinergic neurons from rat brain in culture.
J Physiol (Lond)
426:499-520 .
[Abstract/Free Full Text]
-
Yang J,
Jan YN,
Jan LY
(1995)
Determination of the subunit stoichiometry of an inwardly rectifying potassium channel.
Neuron
14:1047-1054 .
[Web of Science][Medline]
-
Yasuda K,
Raynor K,
Kong H,
Breder CD,
Takeda J,
Reisine T,
Bell GI
(1993)
Cloning and functional comparison of
and opioid receptors from mouse brain.
Proc Natl Acad Sci USA
90:6736-6740 .
[Abstract/Free Full Text]
This article has been cited by other articles:

|
 |

|
 |
 
A. Raveh, I. Riven, and E. Reuveny
Elucidation of the gating of the GIRK channel using a spectroscopic approach
J. Physiol.,
November 15, 2009;
587(22):
5331 - 5335.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
C. C. Young, M. Stegen, R. Bernard, M. Müller, J. Bischofberger, Rüd. W. Veh, C. A. Haas, and J. Wolfart
Upregulation of inward rectifier K+ (Kir2) channels in dentate gyrus granule cells in temporal lobe epilepsy
J. Physiol.,
September 1, 2009;
587(17):
4213 - 4233.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. McDaid, M. A. McElvain, and M. S. Brodie
Ethanol Effects on Dopaminergic Ventral Tegmental Area Neurons During Block of Ih: Involvement of Barium-Sensitive Potassium Currents
J Neurophysiol,
September 1, 2008;
100(3):
1202 - 1210.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. G. Cruz, F. Berton, M. Sollini, C. Blanchet, M. Pravetoni, K. Wickman, and C. Luscher
Absence and Rescue of Morphine Withdrawal in GIRK/Kir3 Knock-out Mice
J. Neurosci.,
April 9, 2008;
28(15):
4069 - 4077.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Kawano, P. Zhao, C. V. Floreani, Y. Nakajima, T. Kozasa, and S. Nakajima
Interaction of G{alpha}q and Kir3, G Protein-Coupled Inwardly Rectifying Potassium Channels
Mol. Pharmacol.,
April 1, 2007;
71(4):
1179 - 1184.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Kulik, I. Vida, Y. Fukazawa, N. Guetg, Y. Kasugai, C. L. Marker, F. Rigato, B. Bettler, K. Wickman, M. Frotscher, et al.
Compartment-dependent colocalization of Kir3.2-containing K+ channels and GABAB receptors in hippocampal pyramidal cells.
J. Neurosci.,
April 19, 2006;
26(16):
4289 - 4297.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
L. Koyrakh, R. Lujan, J. Colon, C. Karschin, Y. Kurachi, A. Karschin, and K. Wickman
Molecular and Cellular Diversity of Neuronal G-Protein-Gated Potassium Channels
J. Neurosci.,
December 7, 2005;
25(49):
11468 - 11478.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Tabata, S. Haruki, H. Nakayama, and M. Kano
GABAergic activation of an inwardly rectifying K+ current in mouse cerebellar Purkinje cells
J. Physiol.,
March 1, 2005;
563(2):
443 - 457.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. Guatteo, C. P. Bengtson, G. Bernardi, and N. B. Mercuri
Voltage-Gated Calcium Channels Mediate Intracellular Calcium Increase in Weaver Dopaminergic Neurons During Stimulation of D2 and GABAB Receptors
J Neurophysiol,
December 1, 2004;
92(6):
3368 - 3374.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Shankar, S. Murugappan, S. Kim, J. Jin, Z. Ding, K. Wickman, and S. P. Kunapuli
Role of G protein-gated inwardly rectifying potassium channels in P2Y12 receptor-mediated platelet functional responses
Blood,
September 1, 2004;
104(5):
1335 - 1343.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. N. Nikolov and T. T. Ivanova-Nikolova
Coordination of Membrane Excitability through a GIRK1 Signaling Complex in the Atria
J. Biol. Chem.,
May 28, 2004;
279(22):
23630 - 23636.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Daniel, A. Rancillac, and F. Crepel
Mechanisms underlying cannabinoid inhibition of presynaptic Ca2+ influx at parallel fibre synapses of the rat cerebellum
J. Physiol.,
May 15, 2004;
557(1):
159 - 174.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Finley, C. Arrabit, C. Fowler, K. F. Suen, and P. A. Slesinger
{beta}L-{beta}M loop in the C-terminal domain of G protein-activated inwardly rectifying K+ channels is important for G{beta}{gamma} subunit activation
J. Physiol.,
March 15, 2004;
555(3):
643 - 657.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Benians, J. L. Leaney, and A. Tinker
Agonist unbinding from receptor dictates the nature of deactivation kinetics of G protein-gated K+ channels
PNAS,
May 13, 2003;
100(10):
6239 - 6244.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. Mao, L. Li, M. McManus, J. Wu, N. Cui, and C. Jiang
Molecular Determinants for Activation of G-protein-coupled Inward Rectifier K+ (GIRK) Channels by Extracellular Acidosis
J. Biol. Chem.,
November 22, 2002;
277(48):
46166 - 46171.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. V. Kuzhikandathil and G. S. Oxford
Classic D1 Dopamine Receptor Antagonist R-(+)-7-Chloro-8-hydroxy-3-methyl-1-phenyl-2,3,4,5-tetrahydro-1H-3-benzazepine hydrochloride (SCH23390) Directly Inhibits G Protein-Coupled Inwardly Rectifying Potassium Channels
Mol. Pharmacol.,
July 1, 2002;
62(1):
119 - 126.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. L Leaney, L. V Dekker, and A. Tinker
Regulation of a G protein-gated inwardly rectifying K+ channel by a Ca2+-independent protein kinase C
J. Physiol.,
July 15, 2001;
534(2):
367 - 379.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
C.-C. Shieh, M. Coghlan, J. P. Sullivan, and M. Gopalakrishnan
Potassium Channels: Molecular Defects, Diseases, and Therapeutic Opportunities
Pharmacol. Rev.,
December 1, 2000;
52(4):
557 - 594.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. Guatteo, F. R. Fusco, P. Giacomini, G. Bernardi, and N. B. Mercuri
The weaver Mutation Reverses the Function of Dopamine and GABA in Mouse Dopaminergic Neurons
J. Neurosci.,
August 15, 2000;
20(16):
6013 - 6020.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Wickman, C. Karschin, A. Karschin, M. R. Picciotto, and D. E. Clapham
Brain Localization and Behavioral Impact of the G-Protein-Gated K+ Channel Subunit GIRK4
J. Neurosci.,
August 1, 2000;
20(15):
5608 - 5615.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. V. Kuzhikandathil and G. S. Oxford
Dominant-Negative Mutants Identify a Role for Girk Channels in D3 Dopamine Receptor-Mediated Regulation of Spontaneous Secretory Activity
J. Gen. Physiol.,
June 1, 2000;
115(6):
697 - 706.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Yakubovich, V. Pastushenko, A. Bitler, C. W Dessauer, and N. Dascal
Slow modal gating of single G protein-activated K+ channels expressed in Xenopus oocytes
J. Physiol.,
May 1, 2000;
524(3):
737 - 755.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A B Harkins, S Dlouhy, B Ghetti, A L Cahill, L Won, B Heller, A Heller, and A P Fox
Evidence of elevated intracellular calcium levels in weaver homozygote mice
J. Physiol.,
April 15, 2000;
524(2):
447 - 455.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. K. Bradley, W. J. Hatton, H. S. Mason, R. L. Walker, E. R. M. Flynn, J. L. Kenyon, and B. Horowitz
Kir3.1/3.2 encodes an IKACh-like current in gastrointestinal myocytes
Am J Physiol Gastrointest Liver Physiol,
February 1, 2000;
278(2):
G289 - G296.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Inanobe, Y. Horio, A. Fujita, M. Tanemoto, H. Hibino, K. Inageda, and Y. Kurachi
Molecular cloning and characterization of a novel splicing variant of the Kir3.2 subunit predominantly expressed in mouse testis
J. Physiol.,
November 15, 1999;
521(1):
19 - 30.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
B. Liss, A. Neu, and J. Roeper
The weaver Mouse gain-of-function Phenotype of Dopaminergic Midbrain Neurons Is Determined by Coactivation of wvGirk2 and K-ATP Channels
J. Neurosci.,
October 15, 1999;
19(20):
8839 - 8848.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
P. Hou, S. Yan, W. Tang, and D. J. Nelson
The Inwardly Rectifying K+ Channel Subunit GIRK1 Rescues the GIRK2 weaver Phenotype
J. Neurosci.,
October 1, 1999;
19(19):
8327 - 8336.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
P. Jensen, D. J. Surmeier, and D. Goldowitz
Rescue of Cerebellar Granule Cells from Death in weaver NR1 Double Mutants
J. Neurosci.,
September 15, 1999;
19(18):
7991 - 7998.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Takigawa and C. Alzheimer
G protein-activated inwardly rectifying K+ (GIRK) currents in dendrites of rat neocortical pyramidal cells
J. Physiol.,
June 1, 1999;
517(2):
385 - 390.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. B. Stevens, B. S. Shah, R. D. Pinnock, and K. Lee
Bombesin Receptors Inhibit G Protein-Coupled Inwardly Rectifying K+ Channels Expressed in Xenopus Oocytes through a Protein Kinase C-Dependent Pathway
Mol. Pharmacol.,
June 1, 1999;
55(6):
1020 - 1027.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
K.-i. Morishige, A. Inanobe, Y. Yoshimoto, H. Kurachi, Y. Murata, Y. Tokunaga, T. Maeda, Y. Maruyama, and Y. Kurachi
Secretagogue-induced Exocytosis Recruits G Protein-gated K+ Channels to Plasma Membrane in Endocrine Cells
J. Biol. Chem.,
March 19, 1999;
274(12):
7969 - 7974.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Inanobe, Y. Yoshimoto, Y. Horio, K.-I. Morishige, H. Hibino, S. Matsumoto, Y. Tokunaga, T. Maeda, Y. Hata, Y. Takai, et al.
Characterization of G-Protein-Gated K+ Channels Composed of Kir3.2 Subunits in Dopaminergic Neurons of the Substantia Nigra
J. Neurosci.,
February 1, 1999;
19(3):
1006 - 1017.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Kaupmann, V. Schuler, J. Mosbacher, S. Bischoff, H. Bittiger, J. Heid, W. Froestl, S. Leonhard, T. Pfaff, A. Karschin, et al.
Human gamma -aminobutyric acid type B receptors are differentially expressed and regulate inwardly rectifying K+ channels
PNAS,
December 8, 1998;
95(25):
14991 - 14996.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
G. E. Torres, W. R. Haines, T. M. Egan, and M. M. Voigt
Co-Expression of P2X1 and P2X5 Receptor Subunits Reveals a Novel ATP-Gated Ion Channel
Mol. Pharmacol.,
December 1, 1998;
54(6):
989 - 993.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
M. Yamada, A. Inanobe, and Y. Kurachi
G Protein Regulation of Potassium Ion Channels
Pharmacol. Rev.,
December 1, 1998;
50(4):
723 - 757.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Corey and D. E. Clapham
Identification of Native Atrial G-protein-regulated Inwardly Rectifying K+ (GIRK4) Channel Homomultimers
J. Biol. Chem.,
October 16, 1998;
273(42):
27499 - 27504.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. L. Sodickson and B. P. Bean
Neurotransmitter Activation of Inwardly Rectifying Potassium Current in Dissociated Hippocampal CA3 Neurons: Interactions among Multiple Receptors
J. Neurosci.,
October 15, 1998;
18(20):
8153 - 8162.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
G. Krapivinsky, M. E. Kennedy, J. Nemec, I. Medina, L. Krapivinsky, and D. E. Clapham
Gbeta gamma Binding to GIRK4 Subunit Is Critical for G Protein-gated K+ Channel Activation
J. Biol. Chem.,
July 3, 1998;
273(27):
16946 - 16952.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
W. Jarolimek, J. Baurle, and U. Misgeld
Pore Mutation in a G-Protein-Gated Inwardly Rectifying K+ Channel Subunit Causes Loss of K+-Dependent Inhibition in weaver Hippocampus
J. Neurosci.,
June 1, 1998;
18(11):
4001 - 4007.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
P. A. Slesinger, M. Stoffel, Y. N. Jan, and L. Y. Jan
Defective gamma -aminobutyric acid type B receptor-activated inwardly rectifying K+ currents in cerebellar granule cells isolated from weaver and Girk2 null mutant mice
PNAS,
October 28, 1997;
94(22):
12210 - 12217.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. U. Ehrengruber, C. A. Doupnik, Y. Xu, J. Garvey, M. C. Jasek, H. A. Lester, and N. Davidson
Activation of heteromeric G protein-gated inward rectifier K+ channels overexpressed by adenovirus gene transfer inhibits the excitability of hippocampal neurons
PNAS,
June 24, 1997;
94(13):
7070 - 7075.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. M. Maricich, J. Soha, E. Trenkner, and K. Herrup
Failed Cell Migration and Death of Purkinje Cells and Deep Nuclear Neurons in the weaver Cerebellum
J. Neurosci.,
May 15, 1997;
17(10):
3675 - 3683.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
W. Zhou, C. Arrabit, S. Choe, and P. A. Slesinger
Mechanism underlying bupivacaine inhibition of G protein-gated inwardly rectifying K+ channels
PNAS,
May 22, 2001;
98(11):
6482 - 6487.
[Abstract]
[Full Text]
[PDF]
|
 |
|
|

|