 |
Previous Article | Next Article 
Volume 17, Number 9,
Issue of May 1, 1997
pp. 3024-3037
Copyright ©1997 Society for Neuroscience
A Hierarchy of Hu RNA Binding Proteins in Developing and
Adult Neurons
Hirotaka J. Okano and
Robert B. Darnell
Laboratory of Molecular Neuro-Oncology, The Rockefeller University,
New York, New York 10021
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
FOOTNOTES
REFERENCES
ABSTRACT
The Hu proteins are a group of antigens targeted in an
immune-mediated neurodegenerative disorder associated with cancer. We
have cloned and characterized four members of the Hu
gene family from mouse. We find that the Hu genes encode
a large number of alternatively spliced transcripts to produce a series
of related neuron-specific RNA binding proteins. Despite this
complexity, we have discerned several ordered features of
Hu expression. In the embryo, specific Hu
genes are expressed in a hierarchy during early neurogenesis. In the
E16 developing cortex, mHuB is induced in very early
postmitotic neurons exiting the ventricular zone, mHuD
is expressed in migrating neurons of the intermediate zone, and
mHuC is expressed in mature cortical plate neurons. Such
a hierarchy suggests distinct functional roles for each gene in developing neurons. In the adult, all neurons express some set of
Hu mRNA and protein. However, specific patterns are
evident such that individual neuronal types in the hippocampus,
cerebellum, olfactory cortex, neocortex, and elsewhere express from one
to several Hu genes. The complexity of potential protein
variants within a gene family and of different Hu family
members within a neuron suggests a diverse array of function. Given the
strong homologies among the Hu proteins, the Drosophila
neurogenic gene elav, and the Drosophila
splicing factor sxl, we predict that different
combinations of Hu proteins determine different neuron-specific aspects
of post-transcriptional RNA regulation. Our findings of specific
developmental patterns of expression and the correlation between immune
targeting of the Hu proteins and adult neurodegenerative disease
suggest that the Hu proteins are critical in both the proper
development and function of mature neurons.
Key words:
neuron-specific gene expression;
paraneoplastic
neurologic disease;
RNA binding protein;
Hu onconeural antigen;
autoimmunity
INTRODUCTION
RNA binding proteins specifically expressed in the
nervous system have been described in several species, although their
functions remain unknown. Two distinct families of mammalian
neuron-specific RNA binding proteins (n-RBPs) have been identified as
target antigens in the human paraneoplastic neurological disorders (for
review, see Darnell, 1996 ). The Nova family of proteins, identified as target antigens in a paraneoplastic motor disorder (Buckanovich et al.,
1993 ), harbor three KH-type RNA binding domains also found in
FMR-1, the fragile X mental retardation
gene, and a number of splicing factors (Burd and Dreyfuss, 1994 ; Arning
et al., 1996 ; Min et al., 1996 ). Nova-1 functions as an RNA binding
protein in vitro and is expressed only in CNS neurons in a
restricted pattern during development and adulthood (Buckanovich et
al., 1996 ). The Hu family of proteins was identified as target antigens in a paraneoplastic neurological syndrome (the Hu syndrome) consisting of a diverse set of neuronal degenerations associated with small-cell lung cancer. The defining feature of the Hu syndrome is the presence of
antibodies present in patients' serum and cerebrospinal fluid that
recognize antigens present in small-cell lung tumors and in neurons
(for review, see Posner, 1995 ; Darnell, 1996 ). These antisera have
allowed the cloning of target antigens, which have been used as defined
diagnostic reagents to identify patients with the Hu syndrome. As a
result, it has become clear that many Hu patients develop neurological
degenerations that initially affect discrete areas of the nervous
system, including the dorsal root ganglia, the limbic system,
cerebellum, brainstem, motor, or autonomic nervous system. Most
patients subsequently develop a complex syndrome best characterized as
a multifocal neuronal degeneration and die from neurological causes, on
average, seven months from the time of their diagnosis (Dalmau et al.,
1991 ).
Hu antisera recognize a nuclear antigen present in all neurons but not
expressed in other tissues (Graus et al., 1985 ; Dalmau et al., 1992 ).
Hu antisera also recognize a set of antigens of Mr 35-40 kDa on Western blots of brain or tumor
extracts and were used to clone a brain cDNA, termed HuD,
encoding a target antigen (Szabo et al., 1991 ). Subsequently, two
additional genes encoding target antigens have been identified:
HuC (Szabo et al., 1991 ) or ple21 (Sakai et al., 1993 ) and
Hel-N1 (Levine et al., 1993 ), termed here HuB;
additional antigens are likely to exist (Good, 1995 ).
The Hu family of genes shares homology with the
Drosophila elav and sex lethal
(sxl) genes. These homologies are concentrated in
three RNA recognition motifs present in all of the Hu antigens. The
function that Hu proteins play as RNA binding proteins in the
vertebrate nervous system is not known. elav is essential for neurogenesis in flies, whereas sxl regulates alternative
splicing of its own and tra transcripts. These observations
suggest possible developmental and functional roles for the Hu
proteins. Several in vitro studies have demonstrated that
the Hu proteins bind to RNA. HuB was found to bind to AU-rich RNA
sequences in vitro (Levine et al., 1993 ; Gao et al., 1994 ).
Similar findings subsequently were reported with HuD and a related
protein HuR (Liu et al., 1995 ; Ma et al., 1996 ); recently, the mouse
homolog of HuB has been reported to bind to a GA-rich sequence (Abe et
al., 1996 ). The significance of the AU-rich sequences that Hu proteins
bind could relate to mRNA turnover, although this is uncertain (see Lagnado et al., 1994 ; Zubiaga et al., 1995 ); similar AU-rich sequences may be involved in various aspects of RNA metabolism, including the
regulation of RNA turnover (Shaw and Kamen, 1986 ; Zubiaga et al., 1995 )
and splicing (McMullough and Schuler, 1993 ).
It is unknown whether the clinical diversity seen in the Hu syndrome
correlates in any way with the molecular diversity of the genes
encoding target Hu antigens. In situ hybridization studies with a probe derived from conserved regions of the Hu coding
sequences (King et al., 1994 ) are consistent with immunohistochemical
observations that the Hu antibody binds to all neurons (Posner and
Furneaux, 1990 ). However, no study has been made of the expression
pattern of individual Hu family members by using specific
reagents. The diverse number of Hu genes suggests that
individual Hu transcripts might be expressed at either
different developmental times or in specific subsets of neurons. Such
studies are not only of importance in developing an understanding of
the role that these RNA binding proteins play in the development and
function of neurons but in addressing their role as target neuronal
antigens in autoimmune neurological disease. For example, it is unknown
whether the progression from unifocal to multifocal neurological
disease in Hu patients might correlate with an autoimmune attack
against a succession of Hu antigens.
To address these issues, we have developed gene-specific probes to
study the expression and function of Hu gene family members in the mouse. We have identified four mouse Hu gene family
members (termed mHuA through mHuD)
that encode target antigens reactive with Hu antisera. Each gene has a
complex pattern of alternative splicing, predicting at least 18 different protein variants that can be generated from the four genes.
We have used gene-specific in situ hybridization probes to
identify marked variability in the expression patterns of each
mHu gene within the developing and adult mouse nervous
systems. We present evidence that there is a hierarchy of Hu
expression in early postmitotic neurons, such that
mHuB is expressed in the earliest differentiated
neurons, followed by mHuD and then
mHuC. In addition, in the adult CNS there are several
neuronal cell types that demonstrate specific expression of individual
Hu family members. On the basis of our data, we conclude
that the Hu proteins are likely to play specific roles in discrete sets
of developing and adult neurons, and each may serve as a target antigen
in the Hu neurological syndrome.
MATERIALS AND METHODS
Degenerate oligonucleotide PCR screening. The
published Hu family member sequences show extremely high
amino acid conservation between members. This sequence conservation is
particularly strong (>95%) among each of the three 80 amino acid RNA
recognition motifs (RRMs) present in each family member. Four sets of
degenerate oligonucleotides centering around the conserved eight and
six amino acid RNP1 and RNP2 submotifs within each RRM (FP1, 5 -GGI TAT/C GGI/C TTT/C GTI AAC/T TA; FP2, 5 -GGI TTC/T ATI/C C/AGI/C TTT/C
GAT/C AA; RP1, 5 -AG/AG/A G/ATT G/ATA I/CAC/T A/GAA IAT; RP2, 5 -TTG/A
TCA/G AAI/C CG/TI/C ATA/G AAI CC; I refers to inosine) were used in
several combinations and conditions to amplify sequences from human
fetal cDNA and human hippocampal cDNA library (Stratagene, La Jolla,
CA) DNA. These products were subcloned (TA system, Invitrogen, San
Diego, CA) and analyzed by exclusive colony hybridization by using
HuC, HuD, and HuB (Hel-N1)
probes. Human and mouse cDNA libraries (Stratagene) were screened by
using these clones to identify full-length sequences.
Developmental expression of alternatively processed Hu
transcripts. Total RNA was isolated from E10, E16, P8, and adult
mouse brain as described (Chomcynski and Sacchi, 1987 ). Single-stranded cDNA was synthesized with 5 µg of total RNA in a standard reverse transcriptase reaction primed by random hexamers (Boehringer Mannheim, Indianapolis, IN). PCR was performed with primers specific for cDNAs of
mHuA (P1, 5 -TCACAGTGAAGTTTGCAG; P2,
5 -ATTGACACCAGAAATCCC), mHuB (P1,
5 -TCACTGTAAAGTTTGCTA; P2, 5 -ATTAATTCCAGCCAGACT),
mHuC (P1, 5 -TCAGCGTCAAGTTCGCAA; P2,
5 -GCCACTCATGCCATCGAT), and mHuD (P1,
5 -TTACTGTGAAGTTTGCCA; P2, 5 -GATGTTCATTCCCACAAG) surrounding the
coding region between RRM 2 and RRM 3. PCR reactions containing 2.5 µCi of deoxycytidine 5 [ -32P]triphosphate were run
for 33 cycles (30 sec at 94°C, 30 sec at 58°C, and 45 sec at
72°C), and 10% of the reaction was run on 10% polyacrylamide gel
electrophoresis and exposed to XAR-5 autoradiography film. PCR products
were subcloned and sequenced to confirm their identity.
In situ hybridization. Protocols for hybridizations
were essentially as described (Gibbs and Pfaff, 1994 ). Sense and
antisense RNA probes (250-350 bp) from 3 -UTR of the mouse
Hu clones were transcribed in vitro with T7 RNA
polymerase and [33P]-UTP. Slides were incubated at 50°C
for 30 hr in a moist chamber with 1 × 106 cpm of
labeled probe per 50 µl of hybridization solution. Slides were dipped
in Kodak NTB2 emulsion, exposed in the dark for 7-10 d, developed, and
counterstained with cresyl violet.
Fusion proteins. cDNAs encoding each Hu family
member were cloned into pET21a (Novagen, Madison, WI) such that each
was in an open reading frame encoding the T7 epitope at the N terminus with a histidine tag at the C terminus. After transformation of each
construct into Escherichia coli BL21(DE3)pLysS, the bacteria were grown in LB broth at 37°C for a few hours and induced with 1 mM isopropyl thiogalactoside. Fusion proteins were purified by nickel-chelation chromatography.
Affinity purification of antibody. The full-length HuC
fusion protein was coupled covalently to cyanogen bromide Sepharose 4B
(Pharmacia, Uppsala, Sweden) according to the manufacturer's instructions. Hu antiserum (10 ml) was spun at 40,000 × g to remove precipitates, and the supernatant was incubated
with 2 ml of Hu fusion protein-cyanogen bromide Sepharose overnight in
RIPA buffer (150 mM NaCl, 50 mM Tris, pH 7.4, 0.1% SDS, 0.1% Nonidet P-40, and 0.5% deoxycholate). Sepharose was
washed five times in 50 ml of RIPA, column-eluted with 4 ml of 0.2 M glycine, pH 2.0, neutralized with 1 M Tris,
pH 9.5, and dialyzed against PBS.
Northern blot analysis. Total RNA (15 µg) from the
indicated mouse tissues was run on the 1% agarose-formaldehyde gel and transferred onto nylon filters (Amersham, Arlington Heights, IL). Probe
was prepared by random prime labeling (Prime-It; Stratagene) of 3 UTR
fragments of mHuA or mHuC cDNA and hybridized in
50% formamide at 42°C for 24 hr. Stringent washes were in 0.1× SSC, 0.1% SDS at 55°C, and XAR film exposure was for 72 hr.
Immunohistochemistry. Adult female mice were anesthetized
with ether and were perfused with saline, followed by 4%
paraformaldehyde for 4 hr, and then placed in a 10% sucrose/PBS
solution at 4°C overnight. Frozen sections (11 µm) were cut in the
sagittal plane through the cerebellum and cortex, incubated in 0.3%
H2O2, and washed with PBS. Subsequently,
sections were incubated with primary antibody (affinity-purified Hu
antiserum diluted 1:500 or rabbit anti-glial fibrillary acidic protein
(GFAP) diluted 1:300 in 1% goat serum, PBS) for 48 hr at 4°C.
Immunoreactivity was visualized via the avidin-biotin-HRP technique
(Vectastain Elite Kit, Vector Laboratories, Burlingame, CA), with final
incubation in 0.05% 3-3 -diaminobenzidine tetrahydrochloride with
0.01% H2O2 in 0.05 M Tris buffer
and counterstained in cresyl violet. For immunofluorescence, sections
were incubated with secondary antibodies (FITC anti-rabbit and
rhodamine anti-human; Vector) for 1 hr and washed three times in
PBS.
RESULTS
Cloning of mouse Hu gene family members
To obtain gene-specific probes for analysis of the expression of
Hu family members during mouse development, we used
degenerate oligonucleotide primers derived from a conserved region of
the Hu genes for PCR amplification of cDNA, coupled with
traditional low-stringency cDNA screening, to identify four full-length
mouse genes (mHuA-D) encoding Hu family
members. Figure 1A shows the alignment
of the predicted proteins of the four mHu genes
identified via this approach. These include mouse homologs of several
mammalian and Xenopus Hu genes: mHuA
[corresponding to the Xenopus elrA (Good, 1995 ) and
human HuR (Ma et al., 1996 ) genes], mHuB
(homologous to human Hel-N1; Levine et al., 1993 ),
mHuC [corresponding to the human HuC gene
(Szabo et al., 1991 ), also known as ple21 (Sakai et al., 1993 )], and
mHuD (corresponding to the human HuD gene; Szabo et al., 1991 ). In each case there is extremely high sequence homology between individual family members within and across species. This homology is greatest in the RNA recognition motifs (RRM), including RRM 1 and RRM 2, regions thought to encode the Hu antigenic epitopes (Manley et al., 1995 ). Moreover, the region of greatest variability between the predicted proteins, and thereby potentially a
region related to gene-specific function, lies in the spacer region
between RRM 2 and RRM 3. The mouse Hu genes are highly homologous to the Drosophila elav and sxl
proteins, as noted for previously cloned Hu genes. An
analysis of the similarity of these genes (Fig. 1B)
indicates that, of the four mHu genes,
mHuA is the most closely related to both
elav and sxl. Similarly, analysis of the
evolutionary relationship among these genes (Fig. 1C)
suggests that the ancestral Hu gene is
mHuA, and the most recently diverged members are
mHuB and mHuD.
Fig. 1.
A, Amino acid alignments of
Hu-related proteins. The deduced amino acid sequence for four mouse
Hu genes (mHuA, mHuB, mHuC, mHuD) is
compared with the Drosophila elav and sxl
genes. Residues identical to the consensus are shown in bold
type, and conservative substitutions are shown
gray-shaded. The extent of RNA recognition motifs
(RRM) 1-3 is indicated.
B, Sequence distances between mHu proteins and the
Drosophila elav and sxl proteins.
Numbers shown represent percentage of similarity or
percentage of divergence between the sequences shown in
A. Amino acid sequences were aligned by using the
Megalign program in the DNASTAR software package. C,
Phylogenetic tree comparing the ancestral relationships between the mHu
proteins and the Drosophila elav and sxl
proteins. The scale beneath the tree measures sequence
distances. The sequence relationships were determined by using the
Megalign program to compare the sequences shown in
A.
[View Larger Version of this Image (80K GIF file)]
Alternative splicing in the Hu
gene family
A series of alternatively spliced transcripts was identified
during the course of cDNA cloning, including splice variants in both
the coding sequence and untranslated regions (UTRs). Numerous splice
variants for the mHu genes were found to be restricted to the spacer region, including some previously identified splice variants (Szabo et al., 1991 ; Gao et al., 1994 ; Liu et al., 1995 ). To
explore the splicing variation in this region systematically and to
confirm the existence and distribution of each coding variant in the
developing and adult nervous system, we performed RT-PCR analysis of
brain RNAs, using PCR primers flanking this spacer region. Using
primers specific to each of the four Hu genes, we demonstrated that amplified cDNA products were derived from RNA in an
RT-dependent manner and confirmed their identity by cloning and
sequencing the PCR products (Fig. 2A).
The HuB gene produced a splice variant (previously reported
as Hel-N2; Gao et al., 1994 ) for which the expression was
restricted to mouse embryogenesis, whereas HuC and
HuD produced splice variants expressed during development of
the nervous system and in adulthood. Figure 2B shows
the spectrum of coding region variants that were identified. In each
case splicing variants conform to a specific pattern in which one
splice donor (the coding sequences of which end in QRFR) is spliced
alternatively to one of three different splice acceptors (Table
1). The mHuC transcript uses one unique
splice acceptor to generate splice variant 3 and shows the highest
degree of complexity of spacer region alternative splice variants
throughout development. We confirmed that the sequence variation
corresponded to alternative splicing by sequencing genomic
mHuB and mHuC clones (data not shown), which showed the same intron structure in this region as
previously reported for the human HuD gene (Liu et al.,
1995 ).
Fig. 2.
Alternative splicing of mouse Hu
transcripts. A, Location of alternative splicing in
Hu transcripts and the origin of primers for PCR. Two
alternative splicing sites are shown. The site labeled ATG includes splice variants encoding alternative start
codons, and the site labeled sv1-4 includes splice
variants within the spacer region between RRM 2 and
RRM 3. B, Developmental analysis of
splice variants sv1-4 by RT-PCR. Total RNA from the
mouse brain of indicated developmental stage was reverse-transcribed
with (lanes marked +) or without (lanes marked ) RT and amplified by
PCR with gene-specific primers, the locations of which are indicated by
arrows in A. The name of each
splicing variant is indicated and corresponds with the labels used in
Table 1. Because sv2A and sv2B of HuB are not able to be
distinguished by RT-PCR, both simply are named as sv2
here. DNA size markers are shown on the left (in bp).
C, Schematic drawing of Hu UTR
alternative splice variants. ATG indicates putative
initiation codons, and pA indicates polyadenylation
sites found in cDNA clones. There is no apparent correlation between 5
or 3 UTR sequences between Hu families.
[View Larger Version of this Image (28K GIF file)]
Table 1.
Summary of Hu coding region alternate splice
variants
| Variant |
Sequence |
|
| HuA |
| sv4 |
QRFR---------------------------FSP |
| HuB |
| sv2A |
QRFRLDNLLNMAYGVKR--------------FSP |
| sv2B |
QRFRLDNLLNMAYGVKR--------------FSP |
| sv4 |
QRFR---------------------------FSP |
| HuC |
| sv1 |
QRFRLDNLLNMAYGVKS-------PLSLIARFSP |
| sv2 |
QRFRLDNLLNMAYGVKR--------------FSP |
| sv3 |
QRFR--------------------PLSLIARFSP |
| sv4 |
QRFR---------------------------FSP |
| HuD |
| sv1 |
QRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSP |
| sv2 |
QRFRLDNLLNMAYGVKR--------------FSP |
| sv4 |
QRFR---------------------------FSP |
|
|
Splice variants 1-4 from the spacer region between RRM 2 and RRM
3 (as illustrated in Fig. 2A) are shown. Variants
from each gene are named on the left, and sequences are shown in
single-letter amino acid code, with gaps as hyphens. Alternate splice
junctions were confirmed by cloning and sequencing mouse genomic clones (data not shown).
|
|
Numerous splice variants also were found in the noncoding region of
Hu gene family members (Fig. 2C). These include
transcripts with alternative start codons in mHuB and
mHuC yielding potential additional protein variants
(Fig. 2C); such a variant 5 end also was found to be
encoded in human HuA transcripts but was not found in the
mouse (data not shown). The 3 UTR coding variants included alternative
polyadenylation sites (mHuA and mHuB)
and true alternative exon usage (mHuB). These
observations suggest that the Hu noncoding regions may play
specific roles in the post-transcriptional regulation of the
Hu mRNAs (see below). The complexity of the UTR splicing variation in the mHu genes increases in relation to
the apparent evolutionary age of each gene family member. Thus
HuB, the presumed ancestral mHu gene, shows
the greatest complexity of UTR splice variants (4).
Hu expression
The expression of the human Hu antigen has been reported to be
restricted to brain (Dalmau et al., 1992 ), and expression of several Hu genes has been reported to be neuron-specific,
with the exception of mHuB mRNA, which also may be weakly
expressed in testis (King et al., 1994 ), and mHuA homologs,
which were reported to be ubiquitously expressed in human and
Xenopus tissues (Good, 1995 ; Ma et al., 1996 ). Because
ubiquitous expression of HuA would seem incongruous with the
reported neuron-specific expression of the Hu antigen, we evaluated
both the expression of the Hu antigen by immunohistochemical and
Western blot analysis and expression of the mHuA gene.
Immunohistochemical analysis of E16 mouse embryos, including several
neuronal and non-neuronal tissues, demonstrated intense reactivity with
the Hu antigen in all neurons of the central and peripheral nervous
systems but no reactivity with non-neuronal tissues, consistent with
previous reports (Fig. 3; Posner and Furneaux, 1990 ;
Dalmau et al., 1992 ; Marusich et al., 1994 ; Barami et al., 1995 ).
Hu-positive cells had the morphology of neurons in the adult (Fig.
3I); interestingly, newly born periventricular neurons present in the E16 cortex showed predominantly cytoplasmic staining (Fig. 3H), whereas adult neurons showed both
strong nuclear and cytoplasmic staining (Fig. 3I). To
demonstrate whether this reactivity was restricted to neurons, we
double-stained sections with GFAP and Hu antisera. Hu and GFAP reactive
cells were mutually exclusive (Fig. 3J).
Fig. 3.
Distribution of Hu immunoreactivity in the E14 and
adult mouse. A, Sagittal section (11 µm) from E14
mouse stained with affinity-purified Hu antiserum. There is intense
immunoreactivity in the central and peripheral nervous systems,
including the telencephalon, cerebellum, and spinal cord, but no
reactivity in other tissues, including liver and heart.
B, Hu immunoreactivity in E14 trigeminal ganglia. C, Hu immunoreactivity in E14 cerebellum, demonstrating
intense staining in the developing cerebellum with no staining of the choroid plexus. D, Hu immunoreactivity in E14 dorsal
root ganglia. E, Hu immunoreactivity in E14 olfactory
epithelium. F, Hu immunoreactivity in E14 retina; Hu
staining is intense in ganglion cell layer (open arrow)
but absent in the ventricular surface (solid arrow),
except in some scattered cells (arrowheads).
G, Hu expression in the ganglion cells in the small
intestine. H, High-power magnification of Hu
immunoreactivity in E14 cortex. Note the cytoplasmic staining in the
developing cells (arrowheads). I,
High-power magnification of Hu immunoreactivity in a horizontal section
(11 µm) of adult cortex, demonstrating that Hu reactivity in the
differentiated neuron is both nuclear and cytoplasmic
(arrows). J, Immunofluorescence double
exposure of GFAP (green) and Hu
(red) immunoreactivity in a horizontal section of adult
cortex, demonstrating that the two are mutually exclusive.
tl, Telencephalon; tgg, trigeminal ganglia; sc, spinal cord; cb, cerebellum;
ht, heart; lv, liver; cpx,
choroid plexus; drg, dorsal root ganglia;
ofe, olfactory epithelium; int, small
intestine. Scale bars: 2 mm in A; 160 µm in
B-E, G; 80 µm in F; 20 µm in H-J.
[View Larger Version of this Image (122K GIF file)]
We also examined Hu antigen expression by Western blot analysis. When
protein extracts from multiple mouse tissues were run on SDS-PAGE and
probed with Hu antisera, immunoreactive proteins were detected only in
brain extracts (Fig. 4A), consistent
with a similar analysis of human tissues (Dalmau et al., 1992 ). One explanation for the observed restricted Hu antigen expression and the
broad distribution of HuA homolog mRNAs is that the HuA genes may encode a protein that is not reactive with Hu antisera (Ma et
al., 1996 ). We examined this possibility by expressing full-length
coding sequence for the mHu genes as bacterial fusion proteins and by probing Western blots with Hu antisera. The mHuA fusion
protein was reactive at high titer with Hu antisera, but not with
control antisera (Fig. 4A; data not shown). When we
compared the reactivity of the four mHu fusion proteins, we found that each was reactive at high titer with Hu antisera obtained from three
different Hu patients but showed no reactivity with control serum (Fig.
4B; data not shown). Because we also found similar immunoreactivity with each of the four human Hu fusion proteins (data
not shown), we conclude that each of the four Hu genes
encodes potential autoantigens in the Hu paraneoplastic
disorder. The apparent antigenicity of each gene product varies; when
Hu immunoreactivity was normalized for the amount of fusion
protein present in each assay (assessed with a T7 antibody directed
against each Hu fusion protein; Fig. 4B), we found
that the HuC gene encoded the most immunoreactive and
mHuA the least immunoreactive epitope, differing by a
factor of ~5 (assessed by densitometry; data not shown). The greater
sensitivity of our Western assay may account for the discrepancy
between these results and a previous report in which 125I
protein-A detection was used to assay the reactivity of Hu disease antisera with HuA fusion protein (Ma et al., 1996 ).
Fig. 4.
Western blot analysis of Hu antigen expression
in vivo and in vitro. A, Hu expression in
the developing mouse brain and various adult tissues. Total cellular
extracts from the indicated tissues, National Institutes of Health 3T3
cells, or purified mouse HuA fusion protein were run on 10% SDS-PAGE,
transferred to nitrocellulose, and probed with Hu antiserum. The blot
also was probed with an anti-tubulin antibody, which revealed that each
of the nonbrain samples had at least as much (in most cases greater)
protein loaded as in the lanes marked Brain or
Cerebellum (data not shown). B, Hu
antiserum recognizes recombinant fusion proteins of all four Hu family
members. Equal amounts of T7-tagged bacterial fusion proteins of mouse
HuA, HuB, HuC, and
HuD were probed with paraneoplastic Hu antiserum
(Hu Serum). The blot also was probed with normal human
serum (Normal Serum), which was not reactive with the Hu fusion proteins, and an anti-T7 tag monoclonal antibody (Anti T7 Tag) used as a positive control and used to normalize
the quantity of fusion protein present in each sample. Identical
results were obtained with three different Hu disease antisera and Hu
antisera affinity-purified with HuC fusion protein (data not
shown).
[View Larger Version of this Image (44K GIF file)]
Because several reports indicated that mRNA-encoding HuA homologs were
ubiquitously expressed, we evaluated the tissue distribution of
mHuA gene expression in the mouse. Northern blot analysis
with an mHuA coding region probe to examine mRNA in multiple
tissues (Fig. 5) confirmed that mHuA RNA
expression could be detected ubiquitously, whereas mHuC
expression was restricted to brain. We next examined whether subtle
differences in brain versus nonbrain mHuA mRNA, such as
small alternatively spliced exons not detectable by Northern blot
analysis, could account for the discrepancy between the restricted
distribution of the Hu protein and mRNA. We cloned full-length cDNAs
encoding mHuA from a nonbrain (spleen) tissue that does not
express immunoreactive Hu antigen (Fig. 4A; data not
shown) and compared the sequences with brain mHuA cDNA
sequences. These data revealed that the brain and spleen
mHuA mRNA were identical within the full coding region and
regions of the UTR that were sequenced. We conclude that the
discrepancy between the restricted expression of Hu protein and the
widespread expression of the mHuA gene may be a result of
post-transcriptional regulation of mHuA gene expression.
Such regulation also may occur with HuB expression, because
we and others detect no protein expression in ovary or testis (Fig.
4A; Dalmau et al., 1992 ), whereas others have found
expression of HuB homolog mRNA in these tissues (King et
al., 1994 ; Good, 1995 ). Finally, we note that determination of the
tissue pattern of mHuA protein expression will need to await the
development of specific antibodies.
Fig. 5.
Northern blot analysis of
HuA and HuC in various mouse
tissues. Fifteen micrograms of total RNA from the indicated adult mouse tissues were separated on an agarose-formaldehyde gel, transferred onto
nylon membranes, and hybridized with 32P-labeled 3 UTR
cDNA probes specific for mHuA or
mHuC. RNAs were visualized with ethidium bromide for
examining the equivalent amount of each sample (data not shown).
[View Larger Version of this Image (43K GIF file)]
Tissue and developmental expression of individual Hu
gene family members
To examine the expression pattern of individual Hu
genes, we performed in situ hybridization with gene-specific
probes. Sense and antisense 3 UTR sequences from the cloned
mHu genes were transcribed and used to probe sections from
developing and adult mice. Figure 6 shows a panel of
mouse embryonic and adult sections probed with an antisense riboprobe
specific for mHuC. In each section the hybridization pattern
is restricted entirely to the nervous system. At E16 it is evident that
neurons of the central and peripheral nervous systems express
HuC mRNA; there is robust reactivity in the retina,
telencephalon, midbrain, hindbrain, and spinal cord and peripheral
nervous system, including the trigeminal ganglia and dorsal root
ganglia (Fig. 6A). At P0, mHuC expression remains tightly restricted to the nervous system (Fig.
6B), and in the adult brain there is widespread
reactivity restricted to cells of the central and peripheral nervous
systems (Fig. 6C). Similar nervous system-specific
expression was evident for all mHu probes (except
mHuA) throughout embryogenesis and in adulthood (see below;
data not shown).
Fig. 6.
Specific expression of mHuC in the
nervous system; dark-field microscopy of HuC in situ
hybridization in the mouse. Sagittal sections (11 µm) of E16
(A) and P0 (B) mouse and a horizontal section (11 µm) of adult mouse brain (C) were
hybridized with 33P-labeled antisense
mHuC-specific cRNA probe. Mouse HuC
expression is observed in the telencephalon, cerebellum, spinal cord,
dorsal root ganglia, and olfactory epithelium at E16 and P0 and is
absent in non-neural tissues. Expression in the nervous system persists through adulthood (C) and remains absent in non-neural
tissue (data not shown). No reactivity was observed with a sense
riboprobe (data not shown). bs, Brain stem;
tg, trigeminal ganglia; rt, retina;
tl, telencephalon; cb, cerebellum;
drg, dorsal root ganglia; ofe, olfactory
epithelium; sp, spinal cord. Scale bar, 2 mm.
[View Larger Version of this Image (42K GIF file)]
Immunohistochemical analysis has indicated previously that Hu protein
expression is induced within hours of neurogenesis in the developing
avian brain, when it is measured after 3H-thymidine or BrdU
labeling of early postmitotic neurons (Marusich et al., 1994 ; Barami et
al., 1995 ). We compared the early developmental expression of
individual mHu genes with the expression of the Hu antigen.
We assumed in these studies that the Hu immunohistochemical pattern is
a measure of the sum of all Hu antigens expressed (see Fig. 3). At E16
in the developing mouse neocortex, immunohistochemical staining with
affinity-purified anti-Hu antibody demonstrated robust reactivity in
the postmitotic neurons of the cortical plate, in migrating neurons of
the intermediate zone, and some reactivity in scattered neurons in the
ventricular zone (Fig. 7A). Similarly, developing neurons of the P9 cerebellum showed Hu immunoreactivity in
the inner cells of the external granular layer (EGL), Purkinje neurons,
and neurons within the internal granular layer (IGL; Fig.
7E). We interpret the Hu immunohistochemical reactivity of a
subset of neurons within the EGL and ventricular zone as consistent with previous reports that Hu protein is induced at the time of neurogenesis.
Fig. 7.
Expression patterns of Hu mRNAs in
developing brain. Sagittal sections (11 µm) of E14 mouse cortex
(Ctx; A-D) and P9 mouse cerebellum
(Cb; E-H) were analyzed by
immunohistochemistry (A, E) and in situ
hybridization (B-D, F-H). Affinity-purified Hu antibody was used for immunohistochemistry (A, E).
Serial sections were hybridized with 33P-labeled antisense
HuB (B, F), HuC
(C, G), and HuD (D,
H) gene-specific 3 UTR cRNA probes. In the developing
cortex, mHuB is expressed in some cells of the
ventricular zone and cells of the intermediate zone;
mHuB diminishes in the cortical plate, with no
expression evident in the outermost differentiated neurons
(arrowheads). mHuC is detected only in
the cortical plate, including the differentiated neurons
(arrowheads). mHuD expression is intense
in the intermediate zone, diminishes in the cortical plate, and is very
weak or absent in the differentiated neurons
(arrowheads). In developing cerebellum, mHuB is expressed primarily in the external granule cell
layer, whereas the expression of mHuC and
mHuD is distributed widely. Purkinje cells
(arrows) express only mHuC. Sections were
counterstained with cresyl violet. ml, Marginal layer;
cp, cortical plate; iz, intermediate
zone; vz, ventricular zone; egl, external
germinal cell layer; m, molecular layer;
p, Purkinje cell layer; igl, internal granule cell layer. Scale bars: 60 µm in A-D; 15 µm
in E-H.
[View Larger Version of this Image (107K GIF file)]
Hierarchies of mHu mRNA expression in
developing neurons
Interestingly, the mHu mRNAs showed a hierarchy of
expression in developing neocortical and cerebellar neurons.
mHuB mRNA was expressed in the very earliest stages of
neural development, with neocortical expression evident in the outer
layer of cells in the ventricular zone, continuing into neurons of the
intermediate zone, and diminishing in neurons of the cortical plate;
mHuC mRNA expression was absent in neurons of the cortical
ventricular zone and intermediate zone but was robustly expressed in
neurons of the cortical plate (Fig. 7B,C). mHuD
expression showed an intermediate pattern of expression, with mRNA
first evident in the intermediate zone neurons and diminishing in
cortical plate neurons (Fig. 7D).
A similar pattern of mHu gene expression was evident
in neurons of the developing cerebellum. Again, mHuB
expression was evident in the most immature neurons of the developing
cerebellum, in the inner layer of the EGL, with some expression
apparent in neurons migrating through the molecular layer, little or no
expression in the IGL, and no expression in Purkinje neurons (Fig.
7F). mHuC expression was robust in
the mature Purkinje neurons and IGL neurons, but also it was evident in
some neurons in the EGL (Fig. 7G). mHuD
expression also was expressed within the developing cerebellum; it
clearly was absent from Purkinje neurons, showed only trace expression
in the EGL, and was detected at an intermediate level in the IGL (Fig.
7H). These data suggest that the
mHuB gene is unique among the mHu
genes in being expressed extremely early in neurogenesis and suggest
that the immunohistochemical reactivity previously observed in early
postmitotic cortical neurons (Marusich et al., 1994 ; Barami et al.,
1995 ) may have represented the HuB protein.
mHu mRNA expression in adult brain
Analysis of the adult neuronal expression of the
mHu genes revealed additional regional differences in
expression patterns of mHuB, mHuC,
and mHuD (Fig. 8 and
Table 2). Within the hippocampus (Fig.
8A-C) mHuB showed restricted expression
limited to CA2-CA3-CA4 pyramidal neurons, with no staining evident in
the dentate neurons or adjacent entorhinal cortex, whereas
mHuC expression was present in all neurons throughout
this region, and mHuD expression was absent in dentate
neurons but concentrated within the pyramidal neurons and adjacent
entorhinal cortex. Within the adult olfactory system (Fig.
8D-F) mHuB was expressed
predominantly within large neurons of the olfactory bulb (mitral
neurons), with only scattered expression in small granule neurons;
there was also robust and specific expression within the accessory
olfactory bulb. mHuD showed an overlapping pattern of
expression that included mRNA within both olfactory mitral and granule
cells, whereas mHuC expression was robust throughout
the olfactory system.
Fig. 8.
In situ hybridization of
Hu mRNAs in adult mouse brain and spinal cord.
Horizontal sections (11 µm) of adult mouse brain and spinal cord were
hybridized with 33P-labeled antisense probes specific for
mHuB (A, D, G, J, M, P), mHuC (B, E, H, K, N, Q), and
mHuD (C, F, I, L, O, R) cRNA probes. Hippocampal formation (Hf), olfactory bulb
(Ob), cerebral cortex (Ctx),
habenula (Hb), spinal cord (Sc), and
cerebellum (Cb) are shown. Note that the hybridization
signal of mHuB is intense in hippocampal pyramidal cells
CA2, CA3, and CA4, mitral cell layer (mt), accessory
olfactory bulb (ao), and dorsal root ganglia, but the
signal is absent in the cerebellum except for some scattered cells in
the granule cell layer (gr). The mRNA of mHuC is widely expressed in the
adult nervous system, including hippocampal dentate gyrus
(dg), pyramidal cells, glomerular
(gl), mitral and granule cell layer
(gr) of olfactory bulb, cortex, corpus striatum
(st), medial habenula (mh), gray
(gm) and white matter (wm) of
spinal cord, dorsal root ganglia (drg), and Purkinje
cells (p). mHuD expression is
prominent in the entorhinal cortex (er), medial habenula, and dorsal root ganglia, but it is absent in dentate gyrus,
corpus striatum, and Purkinje cells. No reactivity was observed with
sense riboprobes (data not shown). v, Third ventricle; mol, molecular layer. Scale bars: 400 µm in
A-C; 300 µm in
D-F; 200 µm in G-I; 300 µm in
J-L; 400 µm in M-O; 100 µm in
P-R.
[View Larger Version of this Image (139K GIF file)]
Within the neocortex (Fig. 8G-I)
mHuB was detectable only in scattered neurons,
mHuC was strongly expressed in all neocortical neurons, and
mHuD was expressed most prominently in the large projection neurons in layer 5. The expression of both mHuC
and mHuD was evident within the medial habenula, whereas
mHuB expression was absent (Fig. 8J-L).
Dorsal root ganglia neurons expressed abundant amounts of
mHuB, mHuC, and
mHuD, whereas neurons within the spinal cord
predominantly expressed mHuC (Fig.
8M-O). In addition, a population of cells present in
the spinal cord white matter expresses mHuC mRNA; the
identity of these cells is unclear; they do express Hu protein by
immunohistochemical assay and are GFAP-negative (data not shown). In
the adult cerebellum (Fig. 8P-R)
mHuB expression is downregulated except for expression
within scattered small cells in the granule layer; the identity of
these cells is unclear. mHuD shows faint expression in
the granule layer, as well as scattered expression in the molecular
layer; again, the identity of the latter cells is unclear; they are
GFAP-negative (data not shown) and may represent expression in
scattered neurons present in the cerebellar molecular layer.
mHuC expression is robust within adult Purkinje and
granule neurons (Fig. 8Q). A summary of mHu
gene expression is presented in Table 2. The results support the
conclusion that mHuC expression is nearly ubiquitous in
mature postmitotic neurons, whereas the cellular distribution and
levels of mHuB and mHuD vary widely
during development and in adulthood.
DISCUSSION
The Hu gene family encodes a complex set of neuronal
RNA binding proteins
We have used degenerate PCR and standard cDNA cloning to identify
four genes encoding mouse homologs of target antigens in the human
Hu paraneoplastic neurological degenerations. Each of these
genes produces a complex set of mRNA variants caused by alternative
splicing in the coding and noncoding regions and caused by the usage of
alternative polyadenylation sites. Although alternative exon usage
within the coding region of some Hu genes has been noted
previously, we have found that the same pattern of alternative exon
usage is conserved in three of the four Hu genes, suggesting that the regulation of splicing at this point is likely to be a
significant point in the regulation of Hu protein function. Splicing
variants are able to generate between one and four variant protein
species from each of the Hu primary transcripts; some additional splice variants (mHuB and
mHuC) add N-terminal coding sequence and alternative
initiator methionines. In total, the four Hu genes encode at
least 18 different potential protein variants.
Alternative splicing of neuronal mRNAs is a widespread phenomenon; in
extreme examples, such as the neuronal neurexin receptor, it is
believed that alternative splicing generates several thousand transcripts from three genes (Ullrich et al., 1995 ). The Hu
genes are unique in this context in that they are RNA binding proteins highly related to sxl. sxl acts in Drosophila to
regulate alternative splicing of its own pre-mRNA, as well as splicing
of the tra pre-mRNA. The high degree of homology between the
Hu genes and sxl (Szabo et al., 1991 ), the
complexity of Hu protein variants, the hierarchical pattern of Hu
expression, and the predominant nuclear localization of the Hu antigens
suggest that the Hu proteins might act to regulate alternative splicing
of neuronal pre-mRNAs. Neuronal pre-mRNAs encoding complex sets of
proteins, such as the neurexins or the Hu proteins themselves in which
the expression of multiple mRNA splice variants are regulated within
subsets of developing and mature neurons, are potential candidates for
targets of Hu action. Such a function might coexist with a cytoplasmic
role for Hu proteins, including binding of AU-rich elements implicated
as Hu binding sites in vitro (Levine et al., 1993 ; Gao et
al., 1994 ; Liu et al., 1995 ; Ma et al., 1996 ). Finally, different Hu
antigens may serve entirely different functions, an issue that could be
approached with antibodies that discriminate between family
members.
The extensive variability in 5 and 3 UTR variants in the
Hu genes may relate to alternative usage of
cis-acting control elements, in particular, variation in
elements regulating expression of individual Hu mRNAs. The
strongest support for this possibility comes from analysis of the
mHuA gene in which expression of the protein and mRNA is
uncoupled, suggesting that mHuA expression is regulated at a
post-transcriptional level. One mechanism for restricting mHuA protein
expression to neurons would be the use of a cis-acting
element within the mHuA mRNA that participates in regulating
neuron-specific translation of the mHuA mRNA; such a
neuronal regulatory element has been found in the BTEB mRNA and
suggested for the paraneoplastic cdr2 antigen mRNA, both of which are
ubiquitously expressed but translated only in neurons and testis
(Imataka et al., 1994 ; Corradi et al., 1997 ).
The role of Hu proteins in neural development
The wide variability in the developmental expression of individual
Hu genes suggests that the different Hu proteins function in
different stages in the early development of postmitotic neurons. By
using in situ probes capable of distinguishing each
Hu family member, we are able to conclude that the
mHuB gene, and to a lesser extent the mHuC gene,
functions specifically in the earliest postmitotic neurons. For
example, we find that the mHuB gene is expressed in neurons
migrating out of the periventricular zone into the intermediate zone.
Similarly, mHuB is robustly expressed in the inner layers of
the cerebellar EGL (see Fig. 6). Previous autoradiographic studies have
shown that the small cells in the superficial layer of the EGL
correspond to proliferating cells, whereas the deeper cells,
corresponding to mHuB (and to a lesser extent
mHuC)-positive cells, are undergoing initial steps of
neuronal differentiation and axon extension (Miale and Sidman, 1961 ;
Fujita, 1967 ). Because our immunohistochemical analysis also
demonstrates Hu protein expression in these neurons, we propose that
the mHuB protein is the earliest Hu family member protein expressed
after cortical neurogenesis and that mHuB, perhaps together
with mHuC, is the earliest Hu family member expressed in
developing cerebellar granule neurons.
Although we did not perform double labeling with mitotic markers such
as BrdU, previous studies have suggested that the Hu antigen is
detectable at or near the time of cell cycle exit in the avian nervous
system (Marusich et al., 1994 ; Barami et al., 1995 ). More generally,
studies of neuronal differentiation in the chick retina demonstrate
that neuronal differentiation markers may be induced within minutes of
exit from the cell cycle (Waid and McLoon, 1995 ). Our data indicate
that each of the three types of differentiating neurons early
postmitotic, migrating, and mature neurons of the cortex and
cerebellum express a unique combination of Hu genes,
suggesting a correlation between neuronal development and the function
of different sets of Hu proteins.
In contrast to the expression of mHuB, the mHuC
gene is expressed nearly ubiquitously in mature postmitotic neurons
during development and adulthood. In several regions of the nervous
system, mHuC seems to be the only mHu gene family
member that is expressed. For example, only mHuC is
expressed in cerebellar Purkinje neurons or hippocampal dentate
neurons, suggesting a specific role for the protein in these neurons.
Similarly, some groups of neurons preferentially express
mHuB or mHuD, although typically they are coexpressed with mHuC. Thus, neurons of the accessory
olfactory bulb express mHuB, whereas neurons of the
habenula, entorhinal cortex, and layer 5 in the neocortex express
mHuD. It is possible that individual splice variants of any
of the Hu genes may further subdivide the apparent patterns
of expression of any one Hu family member into smaller
domains. Taken together, these observations suggest that the
mHu genes perform nonredundant functions. Moreover, the
expression of some Hu genes in specific domains of the
nervous system suggests that they play a role in the development and
function of such regions.
Neuronal RNA binding proteins
One remarkable feature of the current study is the exquisite
tissue specificity with which the Hu genes are expressed
within the nervous system. Most mammalian RNA binding proteins
identified have been found to be ubiquitously expressed, including the
great majority of RRM-containing proteins (see Birney et al., 1993 ; Burd and Dreyfuss, 1994 ). The most significant exceptions to date are
three classes of neuron-specific RBPs. The first class, related to the
hnRNP K protein (Siomi et al., 1993a ; Burd and Dreyfuss, 1994 ), is
exemplified by the paraneoplastic antigen Nova-1 (Buckanovich et al.,
1993 ) and includes the fragile X gene, FMR-1
(Burd and Dreyfuss, 1994 ). Both Nova-1 and FMR-1 are RNA binding
proteins (Siomi et al., 1993b ; Buckanovich et al., 1996 ) believed to be expressed in neurons. However, although FMR-1 is expressed within most
neurons, with some regional variation, it also is expressed outside of
the nervous system (Abitbol et al., 1993 ; Devys et al., 1993 ; Hinds et
al., 1993 ). In contrast, Nova-1 expression is restricted strictly to a
subset of CNS neurons (Buckanovich et al., 1993 , 1996 ), indicating that
its function is unique to neurons. A second class of RRM containing
n-RBPs is related to the hnRNP A/B proteins (Dreyfuss et al., 1993 ) and
includes the Drosophila (Nakamura et al., 1994 ) and mouse
(Sakakibara et al., 1996 ) musashi proteins and the Xenopus
laevis nrp-1 protein (Richter et al., 1990 ). The nrp-1 and
mouse musashi n-RBPs are expressed in the ventricular zone of the
developing neural tube, and musashi is required for the proper
development of adult sensory organs (Nakamura et al., 1994 ).
A third class of n-RBPs consists of RRM-containing proteins related to
the paraneoplastic Hu genes. The closest Hu
relatives in this class are elav, which is required for
neurogenesis in the early embryo (Robinow et al., 1988a ,b ; Yao et al.,
1993 ), and rbp9, which is expressed at later developmental
stages (Kim and Baker, 1993 ). A third more distantly related protein,
cpo, is an RBP for which the expression is restricted
primarily to the developing peripheral nervous system, although it also
is found in some other tissues (Bellen et al., 1992 ). Although
elav and rbp9 are ubiquitously expressed within
the Drosophila nervous system, the Hu genes show
marked variability in both developmental patterns of expression and
tissue distribution within the nervous system. We observed a hierarchy
of Hu gene expression in neuronal development and a great
heterogeneity of Hu gene expression within individual
neuronal types in the adult (see Fig. 8). These results suggest that,
in contrast to ubiquitously expressed RBPs, the Hu genes
perform cell-specific roles in individual stages of differentiating neurons and within specific neuronal types. Clarification of those roles awaits identification of the RNA targets of these proteins in
neurons.
The Hu genes encode a diverse set of
disease antigens
The complexity of expression of the mHu mRNAs not only
suggests specific roles for individual family members but has
implications for the paraneoplastic Hu syndrome. The Hu
genes are the targets of autoimmune attack in the adult brain;
antibodies to HuA (see Fig. 4B), HuB (Dropcho and
King, 1994 ), HuC, and HuD (Szabo et al., 1991 ; Manley et al., 1995 )
fusion proteins now have been documented in the sera of Hu patients.
The initiating antigen expressed in small-cell lung cancers is likely
to be a subset of the neuronal Hu antigens. In an RT-PCR analysis of
mRNA expression in three PND-associated small-cell lung tumors,
HuD, but not HuB (Hel-N1) or
HuC, gene expression was detected (Manley et al., 1995 ). It
remains unclear, however, which Hu antigens serve as targets for the
autoimmune neurological assault.
It is of interest that some of the patterns of Hu expression correlate
with discrete syndromes of neurological dysfunction seen in many
patients presenting with the Hu syndrome (Dalmau et al., 1991 ). Thus,
some Hu patients suffer a pure cerebellar degeneration that cannot be
differentiated from typical paraneoplastic cerebellar degeneration in
which Purkinje neurons are targeted (Dalmau et al., 1991 ). Similarly,
~5% of Hu patients develop a pure limbic encephalopathy referable to
hippocampal dysfunction (Dalmau et al., 1991 ). Although the cellular
level of these neurological disorders is uncertain, pure cerebellar
symptoms correlate with the exclusive expression of mHuC in
Purkinje neurons and the near exclusive expression of mHuC
in adult granule cells; similarly, limbic symptoms correlate with
specific expression of HuC in dentate neurons or to the
subsets of hippocampal pyramidal neurons expressing only HuD
and HuC (see Table 1). Such exclusive vulnerability of some
neurons to autoimmune dysfunction might relate to a lack of redundancy
of Hu antigen expression in these neurons. The most common symptom,
suffered by >70% of Hu patients (Dalmau et al., 1991 ; Posner, 1995 ),
is a dorsal root ganglionopathy, which may correlate with the
vulnerability of neurons in the peripheral nervous system versus CNS
and with the high levels of antigen expression in the adult DRG (see
Fig. 8).
Taken together, our data suggest that finer analysis of the neuronal
dysfunction in adults may be able to be correlated with targeting of
discrete Hu gene family members in various regions of the
nervous system. Conversely, the indiscriminate attack against all Hu
proteins evident in Hu antisera correlates with the multifocal neurological degeneration that 75% of Hu patients ultimately develop (Posner, 1995 ). The progression of unifocal to multifocal neurological symptoms that occurs in most of these patients may correspond to a
progression of autoimmune targeting of specific Hu epitopes to a
targeting of common Hu epitopes.
Conclusions: complexity of the Hu RNA binding proteins
Our work illustrates several levels of complexity in the family of
Hu RNA binding proteins. First, analysis of alternative splice variants
suggests that at least 18 different Hu proteins are encoded by four
genes. Second, the regulation of expression of each gene (and perhaps
each subtype of spliced gene product) seems likely to be regulated at
both the transcriptional and post-transcriptional levels on the basis
of our finding multiple alternate 5 and 3 UTR variants as well as
direct evidence of post-transcriptional regulation of mHuA expression.
Third, within any one neuron it is apparent that different combinations
of Hu genes are expressed. This is well illustrated in both
developing neurons, such as those in the cortex and cerebellum, and in
the adult, where there is differential expression of mHu
genes in the many regions, including the hippocampus, cerebellum,
neocortex, and olfactory bulb. Loss-of-function experiments may be able
to test the prediction that such hierarchies of expression of different
Hu gene products are responsible for some aspect of
complexity within these different neuronal groups.
FOOTNOTES
Received Dec. 24, 1996; revised Feb. 3, 1997; accepted Feb. 11, 1997.
These studies were supported by grants to R.B.D. from the National
Institute of Neurological Disorders and Stroke (RO1 NS34389) and the
Irma T. Hirschl Trust. H.J.O. was supported by National Research
Service Award Postdoctoral Training Grant CA 09673-18. We thank members
of our laboratory for discussion and critical reading of this
manuscript. We also thank Geoff Manley and Ron Buckanovich for useful
discussions in the early stages of this work.
Correspondence should be addressed to Dr. Robert B. Darnell, Laboratory
of Molecular Neuro-Oncology, The Rockefeller University, 1230 York
Avenue, New York, NY 10021.
REFERENCES
-
Abe R,
Yamamoto K,
Sakamoto H
(1996)
Target specificity of neuronal RNA-binding protein, Hel-N1: direct binding to the 3
untranslated region of its own mRNA.
Nucleic Acids Res
24:2011-2016[Abstract/Free Full Text]. -
Abitbol M,
Menini C,
Delezoide A,
Rhyner T,
Vekemans M,
Mallet J
(1993)
Nucleus basalis magnocellularis and hippocampus are the major sites of FMR-1 expression in the human fetal brain.
Nat Genet
4:147-153[Web of Science][Medline].
-
Arning S,
Grüter P,
Bilbe G,
Kramer A
(1996)
Mammalian splicing factor SF1 is encoded by variant cDNAs and binds to RNA.
RNA
2:794-810[Abstract].
-
Barami K,
Iversen K,
Furneaux H,
Goldman SA
(1995)
Hu protein as an early marker of neuronal phenotypic differentiation by subependymal zone cells of the adult songbird forebrain.
J Neurobiol
28:82-101[Web of Science][Medline].
-
Bellen HJ,
Kooyer S,
D'Evelyn D,
Pearlman J
(1992)
The Drosophila couch potato protein is expressed in nuclei of peripheral neuronal precursors and shows homology to RNA-binding proteins.
Genes Dev
6:2125-2136[Abstract/Free Full Text].
-
Birney E,
Kuman S,
Krainer AR
(1993)
Analysis of the RNA-recognition motif and RS and RGG domains: conservation in metazoan pre-mRNA splicing factors.
Nucleic Acids Res
21:5803-5816[Abstract/Free Full Text].
-
Buckanovich RJ,
Posner JB,
Darnell RB
(1993)
Nova, the paraneoplastic Ri antigen, is homologous to an RNA-binding protein and is specifically expressed in the developing motor system.
Neuron
11:657-672[Web of Science][Medline].
-
Buckanovich RJ,
Yang YY,
Darnell RB
(1996)
The onconeural antigen Nova-1 is a neuron-specific RNA binding protein, the activity of which is inhibited by paraneoplastic antibodies.
J Neurosci
16:1114-1122[Abstract/Free Full Text].
-
Burd CG,
Dreyfuss G
(1994)
Conserved structures and diversity of functions of RNA-binding proteins.
Science
265:615-621[Abstract/Free Full Text].
-
Chomcynski P,
Sacchi N
(1987)
Single-step method of RNA isolation by acid guanidinium thiocyanate-phenol-chloroform extraction.
Anal Biochem
162:156-159[Web of Science][Medline].
-
Corradi JP,
Yang CW,
Darnell JC,
Dalmau J,
Darnell RB
(1997)
A post-transcriptional regulatory mechanism restricts expression of the paraneoplastic cerebellar degeneration antigen cdr2 to immune privileged tissues.
J Neurosci
17:1406-1415[Abstract/Free Full Text].
-
Dalmau J,
Graus F,
Rosenblum MK,
Posner JB
(1991)
Anti-Hu associated paraneoplastic encephalomyelitis/sensory neuropathy: a clinical study of 71 patients.
Medicine (Baltimore)
71:59-72.
-
Dalmau J,
Furneaux HM,
Cordon-Cardo C,
Posner JB
(1992)
The expression of the Hu (paraneoplastic encephalomyelitis/sensory neuronopathy) antigen in human normal and tumor tissues.
Am J Pathol
141:881-886[Abstract].
-
Darnell RB
(1996)
Onconeural antigens and the paraneoplastic neurologic disorders: at the intersection of cancer, immunity, and the brain.
Proc Natl Acad Sci USA
93:4529-4536[Abstract/Free Full Text].
-
Devys D,
Lutz Y,
Rouyer N,
Bellocq J,
Mandel J
(1993)
The FMR-1 protein is cytoplasmic, most abundant in neurons, and appears normal in carriers of a fragile X permutation.
Nat Genet
4:335-340[Web of Science][Medline].
-
Dreyfuss G,
Matunis MJ,
Piñol-Roma S,
Burd CG
(1993)
hnRNP proteins and the biogenesis of mRNA.
Annu Rev Biochem
62:289-321[Web of Science][Medline].
-
Dropcho EJ,
King PH
(1994)
Autoantibodies against the Hel-N1 RNA-binding protein among patients with lung carcinoma: an association with type I anti-neuronal nuclear antibodies.
Ann Neurol
36:200-205[Web of Science][Medline].
-
Fujita S
(1967)
Quantitative analysis of cell proliferation and differentiation in the cortex of the postnatal mouse cerebellum.
J Cell Biol
32:277-287[Abstract/Free Full Text].
-
Gao FB,
Carson CC,
Levine T,
Keene JD
(1994)
Selection of a subset of mRNAs from combinatorial 3
untranslated region libraries using neuronal RNA-binding protein Hel-N1.
Proc Natl Acad Sci USA
91:11207-11211[Abstract/Free Full Text]. -
Gibbs RB,
Pfaff DW
(1994)
In situ hybridization detection of trkA mRNA in brain: distribution, co-localization with p75NGFR, and up-regulation by nerve growth factor.
J Comp Neurol
341:324-339[Web of Science][Medline].
-
Good PJ
(1995)
A conserved family of elav-like genes in vertebrates.
Proc Natl Acad Sci USA
92:4557-4561[Abstract/Free Full Text].
-
Graus F,
Cordon-Cardo C,
Posner J
(1985)
Neuronal antinuclear antibody in sensory neuronopathy from lung cancer.
Neurology
35:538-543[Abstract/Free Full Text].
-
Hinds HL,
Ashley CT,
Sutcliffe JS,
Nelson DL,
Warren ST,
Housman DE,
Schalling M
(1993)
Tissue-specific expression of FMR-1 provides evidence for a functional role in fragile X syndrome.
Nat Genet
3:36-43[Web of Science][Medline].
-
Imataka H,
Nakayama K,
Yasumoto K,
Mizuno A,
Fujii-Kuriyama Y,
Hayami M
(1994)
Cell-specific translational control of transcription factor BTEB expression.
J Biol Chem
269:20668-20673[Abstract/Free Full Text].
-
Kim Y-J,
Baker B
(1993)
The Drosophila gene rbp9 encodes a protein that is a member of a conserved group of putative RNA binding proteins that are nervous system-specific in both flies and humans.
J Neurosci
13:1045-1056[Abstract].
-
King PH,
Levine TD,
Fremeau RT,
Keene JD
(1994)
Mammalian homologs of Drosophila ELAV localized to a neuronal subset can bind in vitro to the 3
UTR of mRNA encoding the Id transcriptional repressor.
J Neurosci
14:1943-1952[Abstract]. -
Lagnado CA,
Brown CY,
Goodall GJ
(1994)
AUUUA is not sufficient to promote poly(A+) shortening and degradation of an mRNA: the functional sequence within AU-rich elements may be UUAUUUA(U/A)(U/A).
Mol Cell Biol
14:7984-7995[Abstract/Free Full Text].
-
Levine TD,
Gao F,
King PH,
Andrews LG,
Keene JD
(1993)
Hel-N1: an autoimmune RNA-binding protein with specificity for 3
uridylate-rich untranslated regions of growth factor mRNAs.
Mol Cell Biol
13:3494-3504[Abstract/Free Full Text]. -
Liu J,
Dalmau J,
Szabo A,
Rosenfeld M,
Huber J,
Furneaux H
(1995)
Paraneoplastic encephalomyelitis antigens bind to the AU-rich elements of mRNA.
Neurology
45:544-550[Abstract/Free Full Text].
-
Ma W,
Cheng S,
Campbell C,
Wright A,
Furneaux H
(1996)
Cloning and characterization of HuR, a ubiquitously expressed elav-like protein.
J Biol Chem
271:8144-8151[Abstract/Free Full Text].
-
Manley GT,
Smitt PS,
Dalmau J,
Posner JB
(1995)
Hu antigens: reactivity with Hu antibodies, tumor expression, and major immunogenic sites.
Ann Neurol
38:102-110[Web of Science][Medline].
-
Marusich MF,
Furneaux HM,
Henion PD,
Weston JA
(1994)
Hu neuronal proteins are expressed in proliferating neurogenic cells.
J Neurobiol
25:143-155[Web of Science][Medline].
-
McMullough AJ,
Schuler MA
(1993)
AU-rich intronic elements affect pre-mRNA 5
splice site selection in Drosophila melanogaster.
Mol Cell Biol
13:7689-7697[Abstract/Free Full Text]. -
Miale I,
Sidman RL
(1961)
An autoradiographic analysis of histogenesis in the mouse cerebellum.
Exp Neurol
4:227-296.
-
Min H, Turck CW, Black DL (1996) A new regulatory protein,
KSR, mediates exon inclusion through an intronic splicing enhancer.
Genes Dev, in press.
-
Nakamura M,
Okano H,
Blendy JA,
Montell C
(1994)
Musashi, a neural RNA-binding protein required for Drosophila adult external sensory organ development.
Neuron
13:67-81[Web of Science][Medline].
-
Posner JB
(1995)
Anti-Hu autoantibody-associated sensory neuropathy/encephalomyelitis: a model of paraneoplastic syndrome.
Perspect Biol Med
38:167-181[Web of Science][Medline].
-
Posner JB,
Furneaux HM
(1990)
Paraneoplastic syndromes.
In: Immunologic mechanisms in neurologic and psychiatric disease (Waksman BH,
ed), pp 187-219. New York: Raven.
-
Richter K,
Good PJ,
Dawid IB
(1990)
A developmentally regulated, nervous system-specific gene in Xenopus encodes a putative RNA-binding protein.
New Biol
2:556-565[Medline].
-
Robinow S,
Campos A,
Yao K,
White K
(1988a)
The elav gene product of Drosophila, required in neurons, has three RNP consensus motifs.
Science
242:1570-1572[Abstract/Free Full Text].
-
Robinow S,
Campos A,
Yao K,
White K
(1988b)
The locus Elav of Drosophila melanogaster is expressed in neurons at all developmental stages.
Dev Biol
126:294-303[Web of Science][Medline].
-
Sakai K,
Gofuku M,
Kitagawa Y,
Ogasawara T,
Hirose G,
Yamazaki M,
Koh CS,
Yanagisawa N,
Steinman L
(1993)
A hippocampal protein associated with paraneoplastic neurologic syndrome and small cell lung carcinoma.
Biochem Biophys Res Commun
199:1200-1208.
-
Sakakibara S,
Imai T,
Hamaguchi K,
Okabe M,
Aruga J,
Nakajima K,
Yasutomi D,
Nagata T,
Kurihara Y,
Uesugi S,
Miyata T,
Ogawa M,
Mikoshiba K,
Okano H
(1996)
Mouse musashi-1, a neural RNA binding protein highly enriched in the mammalian CNS stem cell.
Dev Biol
176:230-242[Web of Science][Medline].
-
Shaw G,
Kamen R
(1986)
A conserved AU sequence from the 3
untranslated region of GM-CSF mRNA mediates selective mRNA degradation.
Cell
46:659-667[Web of Science][Medline]. -
Siomi H,
Matunis MJ,
Michael WM,
Dreyfuss G
(1993a)
The pre-mRNA binding K protein contains a novel evolutionarily conserved motif.
Nucleic Acids Res
21:1193-1198[Abstract/Free Full Text].
-
Siomi H,
Siomi M,
Nussbaum R,
Dreyfuss G
(1993b)
The protein product of the fragile X gene, FMR-1, has characteristics of an RNA-binding protein.
Cell
74:291-298[Web of Science][Medline].
-
Szabo A,
Dalmau J,
Manley G,
Rosenfeld M,
Wong E,
Henson J,
Posner JB,
Furneaux HM
(1991)
HuD, a paraneoplastic encephalomyelitis antigen, contains RNA-binding domains and is homologous to Elav and sex lethal.
Cell
67:325-333[Web of Science][Medline].
-
Ullrich B,
Ushkaryov YA,
Sudhof TC
(1995)
Cartography of neurexins: more than 1000 isoforms generated by alternative splicing and expressed in distinct subsets of neurons.
Neuron
14:497-507[Web of Science][Medline].
-
Waid DK,
McLoon SC
(1995)
Immediate differentiation of ganglion cells following mitosis in the developing retina.
Neuron
14:117-124[Web of Science][Medline].
-
Yao K-M,
Samson M-L,
Reeves R,
White K
(1993)
Gene elav of Drosophila melanogaster: a prototype for neuronal-specific RNA binding protein gene family that is conserved in flies and humans.
J Neurobiol
24:723-739[Web of Science][Medline].
-
Zubiaga AM,
Belasco JG,
Greenberg ME
(1995)
The nonamer UUAUUUAUU is the key AU-rich sequence motif that mediates mRNA degradation.
Mol Cell Biol
15:2219-2230[Abstract].
This article has been cited by other articles:

|
 |

|
 |
 
D. A. Ayupova, M. Singh, E. C. Leonard, D. P. Basile, and B. S. Lee
Expression of the RNA-stabilizing protein HuR in ischemia-reperfusion injury of rat kidney
Am J Physiol Renal Physiol,
July 1, 2009;
297(1):
F95 - F105.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
F. Guo, J. Ma, E. McCauley, P. Bannerman, and D. Pleasure
Early Postnatal Proteolipid Promoter-Expressing Progenitors Produce Multilineage Cells In Vivo
J. Neurosci.,
June 3, 2009;
29(22):
7256 - 7270.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. L. McCabe and M. Bronner-Fraser
Essential role for PDGF signaling in ophthalmic trigeminal placode induction
Development,
May 15, 2008;
135(10):
1863 - 1874.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Ratti, C. Fallini, C. Colombrita, A. Pascale, U. Laforenza, A. Quattrone, and V. Silani
Post-transcriptional Regulation of Neuro-oncological Ventral Antigen 1 by the Neuronal RNA-binding Proteins ELAV
J. Biol. Chem.,
March 21, 2008;
283(12):
7531 - 7541.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Zhu, M. N. Hinman, R. A. Hasman, P. Mehta, and H. Lou
Regulation of Neuron-Specific Alternative Splicing of Neurofibromatosis Type 1 Pre-mRNA
Mol. Cell. Biol.,
February 15, 2008;
28(4):
1240 - 1251.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Zhu, H.-L. Zhou, R. A. Hasman, and H. Lou
Hu Proteins Regulate Polyadenylation by Blocking Sites Containing U-rich Sequences
J. Biol. Chem.,
January 26, 2007;
282(4):
2203 - 2210.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. Deschenes-Furry, K. Mousavi, F. Bolognani, R. L. Neve, R. J. Parks, N. I. Perrone-Bizzozero, and B. J. Jasmin
The RNA-Binding Protein HuD Binds Acetylcholinesterase mRNA in Neurons and Regulates its Expression after Axotomy
J. Neurosci.,
January 17, 2007;
27(3):
665 - 675.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. C. Jeyaraj, D. Dakhlallah, S. R. Hill, and B. S. Lee
Expression and distribution of HuR during ATP depletion and recovery in proximal tubule cells
Am J Physiol Renal Physiol,
December 1, 2006;
291(6):
F1255 - F1263.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Zhu, R. A. Hasman, V. A. Barron, G. Luo, and H. Lou
A Nuclear Function of Hu Proteins as Neuron-specific Alternative RNA Processing Regulators
Mol. Biol. Cell,
December 1, 2006;
17(12):
5105 - 5114.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. C. de Rivero Vaccari, G. P. Casey, S. Aleem, W.-M. Park, and R. A. Corriveau
NMDA receptors promote survival in somatosensory relay nuclei by inhibiting Bax-dependent developmental cell death
PNAS,
November 7, 2006;
103(45):
16971 - 16976.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
V. Borrell, B. K. Kaspar, F. H. Gage, and E. M. Callaway
In vivo Evidence for Radial Migration of Neurons by Long-Distance Somal Translocation in the Developing Ferret Visual Cortex
Cereb Cortex,
November 1, 2006;
16(11):
1571 - 1583.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Ratti, C. Fallini, L. Cova, R. Fantozzi, C. Calzarossa, E. Zennaro, A. Pascale, A. Quattrone, and V. Silani
A role for the ELAV RNA-binding proteins in neural stem cells: stabilization of Msi1 mRNA.
J. Cell Sci.,
April 1, 2006;
119(Pt 7):
1442 - 1452.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Fujiwara, Y. Mori, D. L. Chu, Y. Koyama, S. Miyata, H. Tanaka, K. Yachi, T. Kubo, H. Yoshikawa, and M. Tohyama
CARM1 Regulates Proliferation of PC12 Cells by Methylating HuD.
Mol. Cell. Biol.,
March 1, 2006;
26(6):
2273 - 2285.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
C. D. Borgeson and M.-L. Samson
Shared RNA-binding sites for interacting members of the Drosophila ELAV family of neuronal proteins
Nucleic Acids Res.,
November 10, 2005;
33(19):
6372 - 6383.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Y. Tomita, K. Matsumura, Y. Wakamatsu, Y. Matsuzaki, I. Shibuya, H. Kawaguchi, M. Ieda, S. Kanakubo, T. Shimazaki, S. Ogawa, et al.
Cardiac neural crest cells contribute to the dormant multipotent stem cell in the mammalian heart
J. Cell Biol.,
September 26, 2005;
170(7):
1135 - 1146.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Soller and K. White
ELAV Multimerizes on Conserved AU4-6 Motifs Important for ewg Splicing Regulation
Mol. Cell. Biol.,
September 1, 2005;
25(17):
7580 - 7591.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Pascale, M. Amadio, G. Scapagnini, C. Lanni, M. Racchi, A. Provenzani, S. Govoni, D. L. Alkon, and A. Quattrone
Neuronal ELAV proteins enhance mRNA stability by a PKC{alpha}-dependent pathway
PNAS,
August 23, 2005;
102(34):
12065 - 12070.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. Canete-Soler, K. S. Reddy, D. R. Tolan, and J. Zhai
Aldolases A and C Are Ribonucleolytic Components of a Neuronal Complex That Regulates the Stability of the Light-Neurofilament mRNA
J. Neurosci.,
April 27, 2005;
25(17):
4353 - 4364.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. C. Darnell, C. E. Fraser, O. Mostovetsky, G. Stefani, T. A. Jones, S. R. Eddy, and R. B. Darnell
Kissing complex RNAs mediate interaction between the Fragile-X mental retardation protein KH2 domain and brain polyribosomes
Genes & Dev.,
April 15, 2005;
19(8):
903 - 918.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. N. Abrous, M. Koehl, and M. Le Moal
Adult Neurogenesis: From Precursors to Network and Physiology
Physiol Rev,
April 1, 2005;
85(2):
523 - 569.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Yano, H. J. Okano, and H. Okano
Involvement of Hu and Heterogeneous Nuclear Ribonucleoprotein K in Neuronal Differentiation through p21 mRNA Post-transcriptional Regulation
J. Biol. Chem.,
April 1, 2005;
280(13):
12690 - 12699.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
W. Akamatsu, H. Fujihara, T. Mitsuhashi, M. Yano, S. Shibata, Y. Hayakawa, H. J. Okano, S.-i. Sakakibara, H. Takano, T. Takano, et al.
The RNA-binding protein HuD regulates neuronal cell identity and maturation
PNAS,
March 22, 2005;
102(12):
4625 - 4630.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. G. Dayer, K. M. Cleaver, T. Abouantoun, and H. A. Cameron
New GABAergic interneurons in the adult neocortex and striatum are generated from different precursors
J. Cell Biol.,
January 31, 2005;
168(3):
415 - 427.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. C. Schulz, S. A. Noggle, G. M. Palmarini, D. A. Weiler, I. G. Lyons, K. A. Pensa, A. C.B. Meedeniya, B. P. Davidson, N. A. Lambert, and B. G. Condie
Differentiation of Human Embryonic Stem Cells to Dopaminergic Neurons in Serum-Free Suspension Culture
Stem Cells,
December 1, 2004;
22(7):
1218 - 1238.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Miyata, A. Kawaguchi, K. Saito, M. Kawano, T. Muto, and M. Ogawa
Asymmetric production of surface-dividing and non-surface-dividing cortical progenitor cells
Development,
July 1, 2004;
131(13):
3133 - 3145.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J.-Y. Lu and R. J. Schneider
Tissue Distribution of AU-rich mRNA-binding Proteins Involved in Regulation of mRNA Decay
J. Biol. Chem.,
March 26, 2004;
279(13):
12974 - 12979.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Pascale, P. A. Gusev, M. Amadio, T. Dottorini, S. Govoni, D. L. Alkon, and A. Quattrone
Increase of the RNA-binding protein HuD and posttranscriptional up-regulation of the GAP-43 gene during spatial memory
PNAS,
February 3, 2004;
101(5):
1217 - 1222.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. van der Giessen, S. Di-Marco, E. Clair, and I. E. Gallouzi
RNAi-mediated HuR Depletion Leads to the Inhibition of Muscle Cell Differentiation
J. Biol. Chem.,
November 21, 2003;
278(47):
47119 - 47128.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Y. Miyanoiri, H. Kobayashi, T. Imai, M. Watanabe, T. Nagata, S. Uesugi, H. Okano, and M. Katahira
Origin of Higher Affinity to RNA of the N-terminal RNA-binding Domain than That of the C-terminal One of a Mouse Neural Protein, Musashi1, as Revealed by Comparison of Their Structures, Modes of Interaction, Surface Electrostatic Potentials, and Backbone Dynamics
J. Biol. Chem.,
October 17, 2003;
278(42):
41309 - 41315.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Park-Lee, S. Kim, and I. A. Laird-Offringa
Characterization of the Interaction between Neuronal RNA-binding Protein HuD and AU-rich RNA
J. Biol. Chem.,
October 10, 2003;
278(41):
39801 - 39808.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Zhu, R. A. Hasman, K. M. Young, N. L. Kedersha, and H. Lou
U1 snRNP-Dependent Function of TIAR in the Regulation of Alternative RNA Processing of the Human Calcitonin/CGRP Pre-mRNA
Mol. Cell. Biol.,
September 1, 2003;
23(17):
5959 - 5971.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Shu, Y. Li, A. Keller, and L. J. Richards
The glial sling is a migratory population of developing neurons
Development,
July 1, 2003;
130(13):
2929 - 2937.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Li, S. Park, B. Kilburn, M. A. Jelinek, A. Henschen-Edman, D. W. Aswad, M. R. Stallcup, and I. A. Laird-Offringa
Lipopolysaccharide-induced Methylation of HuR, an mRNA-stabilizing Protein, by CARM1
J. Biol. Chem.,
November 15, 2002;
277(47):
44623 - 44630.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Kasashima, E. Sakashita, K. Saito, and H. Sakamoto
Complex formation of the neuron-specific ELAV-like Hu RNA-binding proteins
Nucleic Acids Res.,
October 15, 2002;
30(20):
4519 - 4526.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Z. Nie, J. Wu, J. Zhai, H. Lin, W. Ge, W. W. Schlaepfer, and R. Canete-Soler
Untranslated Element in Neurofilament mRNA Has Neuropathic Effect on Motor Neurons of Transgenic Mice
J. Neurosci.,
September 1, 2002;
22(17):
7662 - 7670.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. C. Beckel-Mitchener, A. Miera, R. Keller, and N. I. Perrone-Bizzozero
Poly(A) Tail Length-dependent Stabilization of GAP-43 mRNA by the RNA-binding Protein HuD
J. Biol. Chem.,
July 26, 2002;
277(31):
27996 - 28002.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Cuadrado, C. Navarro-Yubero, H. Furneaux, J. Kinter, P. Sonderegger, and A. Munoz
HuD binds to three AU-rich sequences in the 3'-UTR of neuroserpin mRNA and promotes the accumulation of neuroserpin mRNA and protein
Nucleic Acids Res.,
May 15, 2002;
30(10):
2202 - 2211.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S.-i. Sakakibara, Y. Nakamura, H. Satoh, and H. Okano
RNA-Binding Protein Musashi2: Developmentally Regulated Expression in Neural Precursor Cells and Subpopulations of Neurons in Mammalian CNS
J. Neurosci.,
October 15, 2001;
21(20):
8091 - 8107.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. J. Lisbin, J. Qiu, and K. White
The neuron-specific RNA-binding protein ELAV regulates neuroglian alternative splicing in neurons and binds directly to its pre-mRNA
Genes & Dev.,
October 1, 2001;
15(19):
2546 - 2561.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Imai, A. Tokunaga, T. Yoshida, M. Hashimoto, K. Mikoshiba, G. Weinmaster, M. Nakafuku, and H. Okano
The Neural RNA-Binding Protein Musashi1 Translationally Regulates Mammalian numb Gene Expression by Interacting with Its mRNA
Mol. Cell. Biol.,
June 15, 2001;
21(12):
3888 - 3900.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
L. B. Nabors, G. Y. Gillespie, L. Harkins, and P. H. King
HuR, a RNA Stability Factor, Is Expressed in Malignant Brain Tumors and Binds to Adenine- and Uridine-rich Elements within the 3' Untranslated Regions of Cytokine and Angiogenic Factor mRNAs
Cancer Res.,
March 1, 2001;
61(5):
2154 - 2161.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
C. M. Brennan, I.-E. Gallouzi, and J. A. Steitz
Protein Ligands to HuR Modulate Its Interaction with Target mRNAs In Vivo
J. Cell Biol.,
September 25, 2000;
151(1):
1 - 14.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
C. D. Mobarak, K. D. Anderson, M. Morin, A. Beckel-Mitchener, S. L. Rogers, H. Furneaux, P. King, and N. I. Perrone-Bizzozero
The RNA-binding Protein HuD Is Required for GAP-43 mRNA Stability, GAP-43 Gene Expression, and PKC-dependent Neurite Outgrowth in PC12 Cells
Mol. Biol. Cell,
September 1, 2000;
11(9):
3191 - 3203.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
M. J. Lisbin, M. Gordon, Y. M. Yannoni, and K. White
Function of RRM Domains of Drosophila melanogaster ELAV: RNP1 Mutations and RRM Domain Replacements With ELAV Family Proteins and SXL
Genetics,
August 1, 2000;
155(4):
1789 - 1798.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
S. Park, D. G. Myszka, M. Yu, S. J. Littler, and I. A. Laird-Offringa
HuD RNA Recognition Motifs Play Distinct Roles in the Formation of a Stable Complex with AU-Rich RNA
Mol. Cell. Biol.,
July 1, 2000;
20(13):
4765 - 4772.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
W. Wang, H. Furneaux, H. Cheng, M. C. Caldwell, D. Hutter, Y. Liu, N. Holbrook, and M. Gorospe
HuR Regulates p21 mRNA Stabilization by UV Light
Mol. Cell. Biol.,
February 1, 2000;
20(3):
760 - 769.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
Y. Nakamura, S.-i. Sakakibara, T. Miyata, M. Ogawa, T. Shimazaki, S. Weiss, R. Kageyama, and H. Okano
The bHLH Gene Hes1 as a Repressor of the Neuronal Commitment of CNS Stem Cells
J. Neurosci.,
January 1, 2000;
20(1):
283 - 293.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
W. Akamatsu, H. J. Okano, N. Osumi, T. Inoue, S. Nakamura, S.-I. Sakakibara, M. Miura, N. Matsuo, R. B. Darnell, and H. Okano
Mammalian ELAV-like neuronal RNA-binding proteins HuB and HuC promote neuronal development in both the central and the peripheral nervous systems
PNAS,
August 17, 1999;
96(17):
9885 - 9890.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
G. E. Aranda-Abreu, L. Behar, S. Chung, H. Furneaux, and I. Ginzburg
Embryonic Lethal Abnormal Vision-Like RNA-Binding Proteins Regulate Neurite Outgrowth and Tau Expression in PC12 Cells
J. Neurosci.,
August 15, 1999;
19(16):
6907 - 6917.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. O. Dalmau and J. B. Posner
Paraneoplastic Syndromes
Arch Neurol,
April 1, 1999;
56(4):
405 - 408.
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. Canete-Soler, D. G. Silberg, M. D. Gershon, and W. W. Schlaepfer
Mutation in Neurofilament Transgene Implicates RNA Processing in the Pathogenesis of Neurodegenerative Disease
J. Neurosci.,
February 15, 1999;
19(4):
1273 - 1283.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Antic, N. Lu, and J. D. Keene
ELAV tumor antigen, Hel-N1, increases translation of neurofilament M mRNA and induces formation of neurites in human teratocarcinoma cells
Genes & Dev.,
February 15, 1999;
13(4):
449 - 461.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
Y. Yannoni and K White
Domain necessary for Drosophila ELAV nuclear localization: function requires nuclear ELAV
J. Cell Sci.,
January 12, 1999;
112(24):
4501 - 4512.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
D Arendt and K Nubler-Jung
Comparison of early nerve cord development in insects and vertebrates
Development,
January 6, 1999;
126(11):
2309 - 2325.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
M.-L. Samson
Evidence for 3' Untranslated Region-Dependent Autoregulation of the Drosophila Gene Encoding the Neuronal Nuclear RNA-Binding Protein ELAV
Genetics,
October 1, 1998;
150(2):
723 - 733.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
U Atasoy, J Watson, D Patel, and J. Keene
ELAV protein HuA (HuR) can redistribute between nucleus and cytoplasm and is upregulated during serum stimulation and T cell activation
J. Cell Sci.,
January 11, 1998;
111(21):
3145 - 3156.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
S.-i. Sakakibara and H. Okano
Expression of Neural RNA-Binding Proteins in the Postnatal CNS: Implications of Their Roles in Neuronal and Glial Cell Development
J. Neurosci.,
November 1, 1997;
17(21):
8300 - 8312.
[Abstract]
[Full Text]
[PDF]
|
 |
|
|