 |
Previous Article | Next Article 
The Journal of Neuroscience, October 15, 2001, 21(20):7985-7992
An NMDA Receptor Signaling Complex with Protein
Phosphatase 2A
Shing Fai
Chan and
Nikolaus J.
Sucher
Department of Biology and Biotechnology Research Institute, The
Hong Kong University of Science and Technology, Clear Water Bay,
Kowloon, Hong Kong Special Administrative Region, China
 |
ABSTRACT |
Regulation of protein phosphatase 2A (PP2A) activity and NMDA
receptor (NMDAR) phosphorylation state contribute to the modulation of
synaptic plasticity, yet these two mechanisms have not been functionally linked. The NMDAR subunit NR3A is equipped with a unique
carboxyl domain that is different from other NMDAR subunits. We
hypothesized that the NR3A C-terminal intracellular domain might serve
as synaptic anchor for the phosphatase in the developing CNS. A cDNA
library was screened by the yeast two-hybrid method using the NR3A
carboxyl domain as the bait. The catalytic subunit of the
serine-threonine PP2A was found to be associated with the NR3A
carboxyl domain. Immunoprecipitation studies indicated that the NR3A
subunit formed a stable complex with PP2A in the rat brain in
vivo. Association of PP2A with NMDARs led to an increase in the
phosphatase activity of PP2A and the dephosphorylation of serine 897 of
the NMDAR subunit NR1. Stimulation of NMDARs led to the dissociation of
PP2A from the complex and the reduction of PP2A activity. A peptide
corresponding to the PP2A-NR3A binding domain functioned as a negative
regulator of PP2A activity. These data suggest that NMDARs are
allosteric modulators of PP2A, which in turn controls their
phosphorylation state. The data delineate a mechanistic model of
the dynamic regulation of a PP2A-NMDAR signaling complex, mediated by
the interaction of NR3A and PP2A, and suggest a novel NMDAR-mediated
signaling mechanism in addition to the traditional ionotropic functions
of NMDARs.
Key words:
protein phosphatase 2A; NMDA; phosphorylation; synapse; neuron; brain; rat
 |
INTRODUCTION |
Signaling through protein
phosphorylation is of importance for the normal development and
function of the nervous system (Walaas and Greengard, 1991 ; Roche et
al., 1994 ; Levitan, 1999 ; Swope et al., 1999 ). The phosphorylation
state of neuronal proteins is tightly balanced and controlled in
vivo by the opposing activities of protein kinases and
phosphatases. The dynamic nature of protein phosphorylation serves to
maintain the efficacy and specificity of intracellular signals, which
participate in the modulation of phosphorylation status, and substrate
specificity of signal transduction proteins (Faux and Scott, 1996 ;
Smart, 1997 ). Accumulating evidence demonstrates that both the temporal
and spatial extent of protein kinases and phosphatases are regulated by
an intricate system of protein-protein interactions (Ziff, 1997 ;
Fraser and Scott, 1999 ).
Protein phosphatase 2A (PP2A) is one of the major
serine-threonine phosphatases that exists as a multisubunit enzyme
complex and is expressed at high levels in the CNS (Strack et al.,
1998 ). The enzyme complex consists of a 36 kDa catalytic subunit
(PP2A-C) and a 65 kDa structural subunit (PP2A-A) forming a core
enzyme, which then associates with a variable regulatory subunit
(PP2A-B) to constitute the heterotrimeric PP2A holoenzyme (Mumby and
Walter, 1993 ). PP2A plays key roles in many fundamental cellular
processes, including signal transduction (Mumby, 1995 ) and gene
expression (Schonthal, 1995 ). There are intriguing functional
similarities between PP2A and NMDA receptors (NMDARs). Both contribute
to the regulation of neural functions such as synaptic transmission and plasticity. For example, previous studies have shown that one form of
synaptic plasticity, long-term depression (LTD) is thought to be
dependent on the change of the phosphorylation state of glutamate
receptors in general (Lee et al., 1998 , 2000 ) and the activity of
phosphatases, possibly PP1 and PP2A in particular (Mulkey et al., 1993 ,
1994 ; Thiels et al., 1998 ). However, the functional relationship
between PP2A and NMDARs and its molecular determinants has not been
defined (Wang et al., 1994 ).
NMDARs are heteromultimeric complexes that are comprised of at least
two types of subunits, the principal subunit NR1 and the modulatory
subunit NR2A-D (Moriyoshi et al., 1991 ; Meguro et al., 1992 ; Monyer et
al., 1992 ). Both types of subunits have carboxyl intracellular domains
(Kutsuwada et al., 1992 ) that interact with associated proteins that
regulate NMDAR function (Sheng and Pak, 1999 ). Recently, an additional
developmentally regulated NMDAR subunit NR3A has been identified
(formerly called -1 or NMDAR-L) (Ciabarra et al., 1995 ; Sucher et
al., 1995 ). This receptor subunit has been shown to attenuate
NMDA-mediated currents when co-expressed with NR1 and NR2 subunits in
Xenopus oocytes (Ciabarra et al., 1995 ; Sucher et al.,
1995 ). Cortical neurons from NR3A "knock-out" mice showed enhanced
NMDA responses and increased dendritic spine density (Das et al.,
1998 ). NR3A is equipped with a unique carboxyl domain that is different
from other NMDAR subunits. We undertook the present study to
investigate whether the NR3A C-terminal intracellular domain might
serve as a target for associated proteins with signaling function in
the developing CNS.
 |
MATERIALS AND METHODS |
Yeast two-hybrid screen. The NR3A cDNA encoding the
full-length intracellular C terminus (NR3Ac,
Gly1-Ser165)
was amplified by PCR. The resulting PCR products were purified using the QIAquick PCR purification kit (Qiagen, Hilden, Germany) and
subsequently subcloned into the expression vector pEG202 in-frame with
a LexA DNA-binding domain. This expression construct, together with a
URA reporter plasmid and a human fetal brain cDNA library in plasmid
pJG4-5, was transformed into yeast strain Saccharomyces cerevisiae EGY48 by the lithium acetate method to screen for
NR3A-associated proteins. The transformants were selected on the basis
of the formation of (1) blue colonies on selective plates lacking
uracil, histidine (-His), and tryptophan, and containing
5-bromo-4-chloro-3-indolyl- -D-galactosidase, and (2) LEU gene expression from a chromosomal lexAop-LEU reporter on
plates lacking leucine (-Leu). Expression of the lacZ reporter gene was
determined by measuring -galactosidase activity using 2-nitrophenyl- -D-galactopyranoside as
substrate as described previously (Rose et al., 1990 ). A series of NR3A
C-terminal deletions were constructed (NR3Ac-1,
Gly1-Phe37;
NR3Ac-2,
Gly1-Gln20;
NR3Ac-3,
Tyr21-Phe37;
NR3Ac-4,
Leu8-His30;
NR3Ac-5,
Val38-Ser165;
NR3Ac-6,
Leu132-Ser165),
transformed into yeast strain Saccharomyces cerevisiae
EGY48, and assayed for -galactosidase activity. The sequences of the constructs were verified by DNA sequencing using the AutoRead Sequencing Kit (Amersham Pharmacia Biotech, Arlington Heights, IL).
Construction of an NR3A without the intracellular carboxyl-domain
by site-directed mutagenesis. Site-directed mutagenesis was
performed as described previously (Ho et al., 1989 ). A pair of primers
(5'-CC ATC CTG ACC ACC ATT TGA GAA CAC ATA GTG CAC AG-3' and 5'-CT GTG
CAC TAT GTG TTC TCA AAT GGT GGT CAG GAT GG-3') encoding the desired
mutations was used to change the first codon of the NR3A intracellular
carboxyl domain into a stop codon that generated an NR3A protein
lacking the intracellular carboxyl-domain (NR3A -c). Mutations were
confirmed by DNA sequencing.
Preparation of synaptic plasma membranes and postsynaptic
densities. Sucrose gradient extraction method
was used to prepare synaptic plasma membranes (SPMs) and
postsynaptic densities (PSDs) as previously described (Rogers et al.,
1991 ). Protein concentration of SPM and PSD was determined by
bicinchoninic acid protein assay (Sigma, St. Louis, MO).
Preparation of cerebrocortical neurons. Cerebrocortical
neurons were prepared from the cerebral cortex of mice at embryonic day
16. Cerebral cortices freed of meninges were incubated in 10 ml of
0.25% trypsin in HBSS without calcium and magnesium (Life Technologies, Gaithersburg, MD) for 5 min at 37°C. Then, the cell suspension was sieved through a 70 mm sterile Mesh nylon filter (Spectrum Medical Industries, New Delhi, India), diluted in warm DMEM containing 10% fetal bovine serum and 2 µM L-glutamine (Life Technologies), and plated on culture dishes coated with 12.5 µg/ml poly-D-lysine (Sigma). The cells were exposed to
40 µM cytosine arabinoside (Sigma) after day 3 and incubated for 24 hr to inhibit astrocytic growth. At day 7 after
in vitro seeding, cultures were harvested, and the resulting
cell pellets were resuspended in RIPA buffer and homogenized in a
Potter-Elvehjem homogenizer. The homogenates were centrifuged at
20,800 × g for 10 min at 4°C to remove the nuclei
and mitochondria. The supernatant was subsequently used for
immunoprecipitation and Western blotting analysis.
Transfection of human embryonic kidney (HEK) 293 cells and
stimulation of NMDARs in transfected HEK 293 cells and cerebrocortical neurons. For transient expression of heteromeric NMDARs, including NR1, NR2B, and NR3A, HEK 293 cells were transiently transfected using
calcium phosphate precipitation. A total of 28 µg of cDNA were
transfected per 100 mm tissue culture plate. The NR1, NR2B, and
NR3A cDNAs were transfected in a 1:2:4 ratio. To prevent NMDAR-mediated cell death of transfected cells, 20 µM
7-chlorokynurenate was added to the culture media. Forty-eight hours
after transfection, cells were harvested and homogenized in RIPA buffer
(150 mM sodium chloride, 1% NP-40, 0.5%
deoxycholic acid, 0.1% SDS, 50 mM
Tris-HCl, pH 7.5, 1 mM EDTA, pH 8, 1 mM EGTA, pH 8, and 20 µM
7-chlorokynurenate). Activation of NMDARs in cerebrocortical neurons
and transfected HEK 293 cells expressing heteromeric NMDARs was induced
by adding 200 µM NMDA, 10 µM glycine, and 2.5 mM
calcium in nominally Mg2+-free Hank's
solution at 37°C for 5 min. Cell extracts were prepared immediately
after the exposure to NMDA.
Assay of endogenous PP2A activity. Endogenous PP2A activity
was determined by the serine-threonine phosphatase assay (Promega, Madison, WI). Tissue samples from rat brain, cell lysates of
transfected HEK 293 cells, and cerebrocortical neurons were homogenized
in RIPA buffer containing a freshly prepared protease inhibitor mixture of 1 mM phenylmethylsulfonyl fluoride (PMSF), 20 µg/ml benzamidine, 10 µM leupeptin, 1 µM pepstatin, and 20 µM
7-chlorokynurenate. Protein concentration of homogenates was determined
by bicinchoninic acid protein assay. A total of 5 µg of homogenate
was used for assay. A PP2A inhibitor, 1 nM
okadaic acid (OA) (Life Technologies Inc.), was added and incubated at
30°C for 30 min.
Peptide synthesis. Synthetic peptide (SP1) was
purified by HPLC (Genemed Synthesis, San Francisco, CA). The amino acid
sequence of the synthetic peptide was: GEHIVHRLLLPRIKNKSKLQYWLHTSQRFHRALNTSF.
Immunoprecipitation, gel electrophoresis, and
immunoblotting. Protein samples from rat brain membrane fractions,
600 µg of SPM and PSD, and cell lysates of transfected HEK 293 cells
and cerebrocortical neurons were used for immunoprecipitation. Primary antibody (10 µg/ml) was added and incubated for 2 hr at 4°C,
followed by 2 hr incubation with GammaBind Plus Sepharose (1:1 slurry
in RIPA buffer). Immunoprecipitates were eluted from GammaBind Plus Sepharose in sample loading buffer (126 mM
Tris-HCl, pH 6.8, 20% glycerol, 4% SDS, 1 M
urea, 300 mM dithiothreitol, 1 mM PMSF, and 0.005% bromophenol blue) at 100°C
for 7 min. Immunoprecipitated samples were analyzed by SDS-PAGE and
immunoblotting after electro-transfer of proteins to polyvinylidene
difluoride membranes. Antibodies used for immunoblotting included
anti-NR3A, provided by J. S. Trimmer (State University of New
York, Stony Brook, NY); anti-NR1 (PharMingen, San Diego, CA);
anti-phospho-NR1 (Upstate Biotechnology, Lake Placid, NY); 6F9 against
PP2A core enzyme and holoenzyme, provided by G. Walter (University of
California, San Diego, CA); PR65 and PR55 antibodies, provided by
B. A. Hemmings (Friedrich Miescher-Institut, Basel, Switzerland);
and anti-PP2A catalytic subunit (PharMingen). Immunoblots were
developed by enhanced chemiluminescence (ECL; Amersham Pharmacia
Biotech) and visualized on Hyperfilm (Amersham Pharmacia Biotech). The
films were scanned into Adobe Photoshop with a Microtek optical scanner
and stored as gray-scale images in TIFF file format. The intensity of
labeling was quantified by measuring the gray value of the pixels
contained in a rectangular area matching the bands of interest. The
mean intensity of labeling obtained for each antibody band was
calculated by subtracting the background value (measured at the site of
the corresponding antibody band in the IgG lane). For the developmental
profile of rat brain, the value obtained at postnatal day 0 (P0)
for both NR1 and NR3A (as illustrated in Fig. 5D) was
selected as a reference point, and all other values were normalized to
the reference point and expressed as percentage.
 |
RESULTS |
Identification of PP2A as an NR3A interacting protein and
characterization of the PP2A-NR3A interaction domain
A human fetal brain cDNA library was screened by the yeast
two-hybrid method using the full-length carboxyl intracellular domain
of the NR3A subunit as the "bait." Approximately 1,000,000 clones
were screened, and initially 36 clones were identified as interactors.
After DNA sequence analysis and database screening using the National
Center for Biotechnology Information Basic Local Alignment Search Tool,
one clone was identified as the -isoform of the catalytic subunit of
the serine-threonine PP2A. Transformation of yeast cells
confirmed that this clone interacted with NR3A and gave the strongest
signal among the other clones in a -galactosidase assay. These
results indicated that the carboxyl intracellular domain of the NR3A
subunit appeared to contain a PP2A binding site. To further define the
nature of interaction between NR3A and PP2A, various bait
fragments containing different amino acid cassettes were constructed
and assayed for their binding activities to PP2A (Fig.
1). The strength of the interaction
between the N-terminal 37 amino acid cassette of the NR3A intracellular
domain (NR3Ac-1) and PP2A was similar to that of the full-length
carboxyl intracellular domain (NR3Ac). Other bait fragments,
NR3Ac-2-4, containing truncated regions of NR3Ac-1, and NR3Ac-5 and
-6 lacking the entire region of NR3Ac-1, were found to bind
weakly to PP2A (Fig. 1). These results suggested that the N-terminal 37 amino acid cassette of the NR3A intracellular domain was necessary and sufficient for binding PP2A.

View larger version (14K):
[in this window]
[in a new window]
|
Figure 1.
Interaction of NR3A with PP2A. The entire carboxyl
intracellular domain of NR3A (NR3Ac:
Gly1-Ser165) and various deletion
constructs (NR3Ac-1-NR3Ac-6) were used in a yeast two-hybrid assay.
Hatched areas correspond to the constructs used in
the assay; open boxes indicate the deletions
that were made from the carboxyl intracellular domain. Corresponding
-galactosidase activities of each construct on interaction with PP2A
are summarized in the histogram. -galactosidase activities are given
in nanomoles per minute per milligram of protein ± SEM.
|
|
Association of PP2A with NR3A mediated through the carboxyl
intracellular domain of NR3A
To investigate whether the association of PP2A with NR3A could be
detected in mammalian cells, HEK 293 cells were transiently transfected
with full-length NR3A cDNA that was cloned previously into the
mammalian expression vector pBK-CMV. Cell extracts from transfected HEK
293 cells were then used for immunoprecipitation. Anti-PP2A monoclonal
antibody 6F9, which was shown previously to recognize and
immunoprecipitate specifically the PP2A core enzyme and holoenzyme
(Kremmer et al., 1997 ), was used for these experiments. The 6F9
antibody co-immunoprecipitated PP2A with NR3A, whereas a control
antibody (anti-rat IgG) did not (Fig. 2A). The expression of
PP2A subunits was detected in lysates from HEK 293 cells transiently
transfected with NR3A (Fig. 2B) by immunoblotting. These results showed that the PP2A formed a complex with NR3A in
mammalian cells. Next, we examined whether the carboxyl intracellular domain of NR3A was essential for interacting with PP2A in mammalian cells. A mutant of NR3A lacking the carboxyl intracellular domain (NR3A
-c) was constructed by site-directed mutagenesis (Fig. 2C). This deletion mutant was transfected into HEK 293 cells, and the cell extracts were subsequently used for
immunoprecipitation. No co-immunoprecipitation (co-IP) between
NR3A -c and PP2A was detected (Fig. 2D). The lack
of association between PP2A and NR3A -c indicated that the carboxyl
intracellular domain of NR3A was necessary for the PP2A-NR3A
interaction in mammalian cells.

View larger version (26K):
[in this window]
[in a new window]
|
Figure 2.
PP2A-NR3A interaction mediated through the
carboxyl intracellular domain of NR3A. A, Lysates from
HEK 293 cells transiently transfected with NR3A were immunoprecipitated
with control IgG antibody (anti-rat IgG) and anti-PP2A monoclonal
antibody 6F9. Western blots were probed with monoclonal antibody
anti-NR3A. Data are representative of six experiments showing similar
results. B, Lysates from HEK 293 cells transiently
transfected with NR3A were separated by SDS-PAGE, and the expression of
PP2A was detected by probing with antibody PR65 (recognizing the
A-subunit), antibody PR55 (recognizing the B-subunit), and antibody
anti-PP2Ac (recognizing the C-subunit). C, Schematic
drawing of NR3A -c. The part of the carboxyl intracellular domain of
NR3A that was deleted is indicated by the dotted line.
TM I-IV designates transmembrane regions I-IV. M
II designates membrane loop M II. D, Lysates
from cells transfected with NR3A -c were immunoprecipitated with
control IgG antibody (anti-rat IgG) or monoclonal antibody 6F9. Western
blots were probed with monoclonal antibody anti-NR3A to detect the
expression of NR3A -c. E, Co-immunoprecipitation of
PP2A with NR3A in rat brain membrane fractions. Lysates from rat brain
membrane fractions were separated by SDS-PAGE, and the expression of
PP2A and NR1 was detected by probing with antibody PR65 (recognizing
the A-subunit), antibody PR55 (recognizing the B-subunit), antibody
anti-PP2Ac (recognizing the C-subunit), and anti-NR1. F,
Immunoprecipitations from synaptic plasma membrane
(SPM) and postsynaptic density
(PSD) fractions from rat brain were performed using
control IgG antibody and monoclonal antibody 6F9, which was used to
immunoprecipitate PP2A (core enzyme and/or holoenzyme). Western blots
were probed with monoclonal antibody anti-NR3A.
|
|
Co-immunoprecipitation of PP2A with NR3A in rat brain
membrane fractions
Similarly to the NMDAR subunit NR1, both NR3A and PP2A were
detected in fractions enriched in SPMs and PSDs (Das et al., 1998 ; Kennedy, 2000 ) (Fig. 2E), a structure thought to be
important in clustering and anchoring of glutamate receptors. To
determine whether PP2A directly interacted with NR3A in the brain,
immunoprecipitation was performed in SPM and PSD fractions from rat
brain. NR3A protein was detected in immunoprecipitates from both SPM
and PSD fractions when anti-PP2A monoclonal antibody 6F9 was used but
not in immunoprecipitates in which a nonspecific anti-rat IgG antibody
was used as control (Fig. 2F). These results provided
direct evidence that PP2A was associated with NR3A in the brain
consistent with the results in HEK 293 cells.
NMDAR-activity-dependent association of PP2A with NR3A in
transfected HEK 293 cells and neurons
After establishing a physical link between PP2A and NR3A, it was
of interest to identify specific signals governing the formation of
the PP2A-NR3A complex. Therefore, we conducted experiments to
investigate whether the NMDAR channel activity could regulate the
association of the PP2A with NR3A in mammalian cells. Transfection of
HEK 293 cells with vectors for NMDAR subunits NR1 + NR2B + NR3A was
performed and the cell extracts were used for immunoprecipitation. Triple combination of transfection was performed because expression of
NR3A by itself did not lead to the formation of NMDAR channels in
Xenopus oocytes (Ciabarra et al., 1995 ; Sucher et al., 1995 ) and in HEK 293 cells (Pérez-Otaño et al., 2001 ), but
expression of NR3A with NR1 and NR2 subunits gave rise to NMDAR-gated
channels with unique properties. These included low
Ca2+ permeability and attenuation of
NMDA-mediated currents in those expression systems
(Pérez-Otaño et al., 2001 ). NR3A protein was detected in
anti-PP2A (6F9) immunoprecipitates in the absence of NMDAR stimulation
by NMDA (Fig. 3A). In
contrast, when NMDARs were activated by NMDA (200 µM
NMDA, 10 µM glycine, and 2.5 mM Ca2+ in nominally
Mg2+-free Hank's solution), PP2A-NR3A
co-IP was not detected (Fig. 3A). At the same time, no
significant change was observed in immunoprecipitates of the NMDAR
subunit NR1 or co-IP of that subunit with NR3A (Fig. 3A).
Similar results were obtained in cerebrocortical neurons (Fig.
3B). The expression of PP2A subunits was detected in lysates from cerebrocortical neurons (Fig. 3C). These results
support the notion that NMDAR channel activity could elicit "on"
and "off" signals to selectively regulate the association of PP2A
with NMDAR in HEK 293 cells and neurons.

View larger version (20K):
[in this window]
[in a new window]
|
Figure 3.
NMDAR activity-dependent association of PP2A with
NR3A in transfected HEK 293 cells and neurons. A, HEK
293 cells expressing heteromeric NMDARs consisting of NR1 + NR2B + NR3A
were incubated in the absence or presence of NMDA (200 µM
NMDA, 10 µM glycine, and 2.5 mM
Ca2+ in nominally Mg2+-free
Hank's solution). Immunoprecipitations were performed using control
IgG antibody, mono clonal antibody 6F9, and NR1. Top, Western
blots probed with monoclonal antibody anti-NR3A and anti-NR1.
Bottom, left, Intensity (mean gray level ± SD) of
NR3A labeling in the presence (co-IP with 6F9, 14.9 ± 2.8; co-IP
with NR1, 103.7 ± 15.3) and absence (co-IP with 6F9, 69.2 ± 2.3; co-IP with NR1, 104.3 ± 12.1) of NMDAR stimulation (co-IP
with 6F9, p < 0.00005; co-IP with NR1,
p < 0.5; n = 3 separate
experiments). B, Cells from cerebrocortical
neurons were incubated in the absence or presence of NMDA. The cell
lysates were subsequently immunoprecipitated with control IgG antibody
or monoclonal antibody 6F9 or NR1. Top, Western blots
probed with monoclonal antibody anti-NR3A and anti-NR1. Bottom,
left, Intensity (mean gray level ± SD) of NR3A labeling
in the presence (co-IP with 6F9, 4.4 ± 1.9; co-IP with NR1,
66.9 ± 14.8) and absence (co-IP with 6F9, 60.6 ± 8.0; co-IP
with NR1, 68.5 ± 8.8) of NMDAR stimulation (co-IP with 6F9,
p < 0.005; co-IP with NR1, p < 0.5; n = 3 separate experiments).
C, Lysates from cerebrocortical neurons were separated
by SDS-PAGE, and the expression of PP2A was detected by probing with
antibody PR65 (recognizing the PP2A-A subunit), antibody PR55
(recognizing the PP2A-B subunit), and antibody anti-PP2Ac (recognizing
the PP2A-C subunit).
|
|
Selective dephosphorylation of NR1 and allosteric activation of
endogenous PP2A activity by the formation of an PP2A-NR3A
complex
NMDAR subunit NR1 is expressed ubiquitously in the brain and is
the principal subunit for the formation of recombinant NMDARs in
neurons (Moriyoshi et al., 1991 ; Meguro et al., 1992 ; Monyer et al.,
1992 ). To delineate the functional consequences of the association of
PP2A with NMDARs, we investigated whether the PP2A-NMDAR complex could
influence the phosphorylation state of the essential NMDAR subunit NR1.
Transfection of HEK 293 cells with combinations of NR1 + NR2B + NR3A
and NR1 + NR2B + NR3A -c was performed, and cell extracts were used
for immunoprecipitation with anti-NR1 antibody. The phosphorylation
state of NR1 was determined by immunoblotting with anti-phospho-NR1
antibody (specific for phosphorylation on Ser 897 residue on NR1)
(Tingley et al., 1997 ). Phospho-NR1 was virtually undetectable in HEK
293 cells expressing NR1 + NR2B + NR3A. In contrast, a significant
level of anti-phopsho-NR1 was observed in HEK 293 cells expressing NR1 + NR2B + NR3A -c or when NR1 + NR2B + NR3A-expressing cells were
stimulated by the addition of NMDA (Fig.
4A). These results
provided evidence that Ser 897 of the NR1 subunit was a direct or
indirect in vivo target for PP2A-mediated dephosphorylation
of NMDARs. Furthermore, the difference between the phosphorylation
level of NMDARs in HEK 293 cells expressing NR1 + NR2B + NR3A and NR1 + NR2B + NR3A -c or NR1 + NR2B + NR3A (stimulated by the addition of
NMDA) indicated that the phosphorylation state of NMDARs was
specifically influenced by the formation of a PP2A-NMDAR complex.

View larger version (22K):
[in this window]
[in a new window]
|
Figure 4.
Dephosphorylation of the NMDAR subunit NR1 and
activation of endogenous PP2A activity in transfected HEK 293 cells.
A, HEK 293 cells were transiently transfected with a
triple combination of NMDAR subunits consisting of NR1 + NR2B + NR3A
and NR1 + NR2B + NR3A -c. After incubation in the absence or
presence of NMDA (200 µM NMDA, 10 µM glycine and 2.5 mM Ca2+
in nominally Mg2+-free Hank's solution), cells were
harvested, and lysates of transfected cells were immunoprecipitated
with monoclonal antibody anti-NR1. Blots were probed with monoclonal
antibody anti-phospho-NR1 to detect the phosphorylated form of NR1. NR1
protein was detected by probing with monoclonal antibody anti-NR1.
Three individual experiments using different batches of protein samples
showed similar results. B, Lysates from transfected HEK
293 cells of NR1 + NR2B + NR3A, NR1 + NR2B + NR3A (treated with NMDA as
above), and NR1 + NR2B + NR3A -c were used to assay the endogenous
PP2A activity using a phosphopeptide as a substrate. Endogenous PP2A
activities are given in picomoles phosphate per minute per microgram of
protein ± SD. Data are representative of three experiments
showing similar results.
|
|
Next, we asked whether the enzymatic activity of PP2A was influenced by
the formation of the PP2A-NMDAR complex. HEK 293 cells were
transfected with a triple combination of NR1 + NR2B + NR3A or NR1 + NR2B + NR3A -c or NR3A alone. Solubilized extracts from these cells
were used to assay endogenous PP2A activity. PP2A activity was found to
be increased more than eightfold in cells transfected with NR1 + NR2B + NR3A compared with the control (8.6 ± 0.5; n = 6;
p < 0.01) ( Fig. 4B). Such an
increase in PP2A activity was observed neither in cells transfected
with NR1 + NR2B + NR3A that were treated with NMDA nor in cells
transfected with the triple combination consisting of NR1 + NR2B + NR3A
-c or NR3A alone (Fig. 4B). These data suggested
that the formation of a complex between NMDARs and PP2A, mediated by
the interaction of the carboxyl intracellular domain of NR3A and PP2A,
activated PP2A. On the other hand, stimulation of NMDARs by the
agonist NMDA in the presence of the co-agonist glycine and the absence of magnesium led to the dissociation of PP2A from the complex resulting
in the attenuation of PP2A activity. In addition, co-expression of
NMDAR subunits NR1, NR2B, and NR3A that would lead to the formation of
NMDAR channels was required for the regulation of PP2A activity.
Blockade of endogenous PP2A activity by a synthetic peptide in
transfected HEK 293 cells, cultured neurons, and rat brain membrane
fractions
A peptide (SP1) corresponding to the PP2A-NR3A binding domain was
synthesized. To test its effect on the PP2A-NR3A interaction and the
resulting activation of PP2A activity, solubilized extract fractions
from HEK 293 cells expressing NR1 + NR2B + NR3A were incubated with
SP1, and the effect of this peptide on endogenous PP2A activity was
determined. A significant reduction of endogenous PP2A activity was
observed in protein extracts from HEK 293 cells expressing NR1 + NR2B + NR3A that were treated with SP1 (5 µM) compared with
control (76.1 ± 1.3%; n = 3; p < 0.001) (Fig. 5A). The
inhibitory effect of SP1 was similar to the blocking effect of the PP2A
inhibitor, OA (Fig. 5A). A dose-response
relationship curve for the effect of SP1 on PP2A activity was
constructed, and the data were fit to the Hill equation (Fig.
5B). SP1 inhibited PP2A activity with an inhibitory
concentration at half maximum (IC50) of 1.5 µM. To test whether SP1 could inhibit PP2A
activity in cultured neurons and the brain, the peptide was added to
the solubilized extract fractions from cerebrocortical neurons in culture and rat brain at different stages of development (postnatal days 0, 4, 8, 12, and 16, and adult). Similar to its effect in HEK 293 cells, SP1 inhibited endogenous PP2A activity in cerebrocortical neurons (Fig. 5C) and the rodent brain at all stages of
development tested (Fig. 5D).

View larger version (17K):
[in this window]
[in a new window]
|
Figure 5.
Blockade of endogenous PP2A activity by a
synthetic peptide (SP1). A, Solubilized
extract fractions from HEK 293 cells transfected with NR1 + NR2B + NR3A
were used to assay the endogenous PP2A activity in the absence
(12.5 ± 0.1 pmol · min 1 · µg 1)
or presence (2.6 ± 0.2 pmol · min 1 · µg 1)
of SP1 (5 µM; p < 0.1 × 10 8; n = 3 separate
experiments). Incubation with the specific PP2A inhibitor 1 nM OA was used as control to block endogenous PP2A activity
in transfected HEK 293 cells. B, Dose-response curve
for the inhibition of PP2A activity by SP1. Solubilized extract
fractions from HEK 293 cells transfected with NR1 + NR2B + NR3A were
used to evaluate the IC50 of SP1 on PP2A activity. The
maximum inhibitory effect of SP1 was normalized to 1. Each data point
represents the average of three experiments ± SD.
C, Solubilized extract fractions from cerebrocortical
neurons were used to determine the endogenous PP2A activity in the
absence (3.6 ± 0.09 pmol · min 1 · µg 1)
or presence (2.9 ± 0.09 pmol · min 1 · µg 1)
of SP1 (5 µM; p < 0.001;
n = 3 separate experiments). D,
Solubilized extract fractions from rat brain at different stages of
development (P0, P4, P8, P12, P16, P20, and adult) were used to assay
the endogenous PP2A activity in the absence or presence of 5 µM SP1, and each data point represents the average of
three experiments ± SD (p < 0.005 at
all points). The developmental protein expression profiles of NR3A and
NR1 were determined, and the expression levels were normalized relative
to P0 and expressed as percentage ± SD. Three individual
experiments using different batches of protein samples showed similar
results.
|
|
Endogenous PP2A activity from rat brain extracts was found to peak
around P8 before dropping significantly around P12 to a low
level of activity in the adult (Fig. 5D). Interestingly, the developmental profile of PP2A activity appeared to parallel the protein
expression profile of NR3A, which increased from P0 to P8, peaked at
P8, and then decreased gradually between P12 and P20, with low levels
of expression in the adult animals. In contrast, the protein expression
level of NR1 showed less variation during the brain development (Fig.
5D). These data are consistent with the idea that both PP2A
and NR3A are developmentally regulated in a similar way, being related
to the functions of each other.
 |
DISCUSSION |
Protein phosphorylation has been established as an important
mechanism for the regulation of NMDAR function. In particular, the
action of protein kinases on NMDARs has been extensively studied. The
NR1 subunit is a target for phosphorylation by both protein kinase A
and protein kinase C (Tingley et al., 1997 ). For example, it was shown
previously that serine residue 897 of the NR1 subunit could be
phosphorylated by protein kinase A. The data of the present study
indicate that the association of PP2A with the NMDAR complex that was
mediated by the NR3A subunit was accompanied by the dephosphorylation of this serine residue. Interestingly, protein kinase A was reported to
be closely associated with the NMDAR complex through its association with the scaffold protein yotiao (Westphal et al., 1999 ). In
addition, another phosphatase, PP1, was also shown to be associated
with yotiao. Thus, both kinases and phosphatases are located in
physical proximity to their target substrates. Together, these results delineate a mechanistic framework explaining earlier findings of an
electrophysiological study that demonstrated that phosphatase inhibitors enhanced NMDA currents, whereas either PP1 or PP2A decreased
the open probabilities of NMDAR-gated channels (Wang et al., 1994 ). To
date, only two features that distinguish NR3A-containing receptors from
those without the subunit have been described: (1) reduced single
channel conductance, and (2) reduced calcium permeability (Das et al.,
1998 ; Pérez-Otaño et al., 2001 ). Both properties
have been shown to be "persistent" characteristics of
NR3A-containing NMDARs in the sense that neither repeated application of NMDA nor pulling of patches changed these properties. It is therefore unlikely that these biophysical properties would be influenced by PP2A or, for that matter, be dependent on the
phosphorylation state of serine 897 of NR1. Thus, possible effects of
the PP2A-NR3A interaction and the phosphorylation state of serine 897 of NR1 on biophysical or pharmacological properties of NMDARs remain to
be established. It is conceivable, however, that the described dependence of the PP2A-NR3A interaction and the phosphorylation of
serine 897 on NMDAR stimulation could be interpreted as a biochemical signal indicating the recent history of activity of individual NMDARs
at synapses. Glutamatergic synapses expressing NMDA receptors containing the NR3A subunit that have not been exposed to glutamate ("unstimulated" synapses) would be characterized by
dephosphorylated serine 897 of NR1. In contrast, synapses that have
previously been exposed to glutamate ("stimulated" synapses) would
be distinguished by phosphorylated serine 897. Serine 897 has been
shown to be directly phosphorylated by protein kinase A, which is
thought to be in close proximity to NR1 through binding to the NR1
associated protein yotiao (Westphal et al., 1999 ). It is not known
whether or not the association between yotiao and NR1 is itself
regulated by phosphorylation.
Thus, it is possible to speculate that protein kinase A, PP2A, and
NMDARs are part of a signaling mechanism linking the history of NMDAR
stimulation to the phosphorylation of state of serine 897 of NR1. Along
these lines, the finding that NR3A knock-out mice showed an increased
density of spines in cortical neurons might indicate that such a
signaling pathway could be involved in the regulation of the growth of
dendritic spines. In fact, NMDAR activity has been implicated
previously in the modulation of dendritic arbors (McAllister et al.,
1996 ) and spines (Woolley and McEwen, 1994 ; Woolley et al., 1997 ),
whereas PP2A has been shown to influence the modification of synaptic
structures (Saito et al., 1995 ; Strack et al., 1997 ).
Numerous studies indicate that modification of protein phosphorylation
is a critical element leading to the induction of synaptic plasticity.
For example, long-term potentiation is accompanied by increased
glutamate receptor phosphorylation through various protein kinases and
a concomitant decrease in protein phosphatase activity (Bliss and
Collingridge, 1993 ; Mulkey et al., 1993 ; Soderling and Derkach, 2000 ).
In contrast, a decrease in synaptic strength, LTD, has been
shown to be dependent on glutamate receptor dephosphorylation mediated
by an increase in the activity of protein phosphatases, possibly PP1
and PP2A (Lee et al., 1998 , 2000 ; Thiels et al., 1998 ). Thus,
coordination of kinase and phosphatase activities is crucial for the
modulation of synaptic plasticity. Intriguingly, our data demonstrate
the association between NMDARs and PP2A in vivo, providing a
direct link between a glutamate receptor and an associated phosphatase.
In particular, the data of the present study delineate a mechanistic
model of the dynamic regulation of a PP2A-NMDAR signaling complex,
mediated by the interaction of NR3A and PP2A, and suggest a novel
NMDAR-mediated signaling mechanism, in addition to the traditional
ionotropic functions of NMDARs.
Our data indicate that the balance between kinase and phosphatase
activities is subject to regulation by NMDAR activity; stimulation of
NMDARs led to a decrease in the enzymatic activity of PP2A and the
physical separation of PP2A from NR3A. It will be interesting to
investigate the fate of the released PP2A. In particular, it will be
important to characterize whether the previously NMDAR-associated PP2A
serves as a signaling molecule acting on downstream targets or whether
it will be recycled for binding to other, inactive NMDARs.
The ubiquitously expressed PP2A plays a major role in many cellular
processes ranging from the initiation of DNA replication to cell growth
and differentiation to apoptosis. The regulation of the enzymatic
activity of PP2A is highly complex, involving a multitude of mechanisms
(Ruediger et al., 1991 ; Sontag et al., 1993 , 1996 ; Lin et al., 1998 ;
Westphal et al., 1998 ; Price and Mumby, 1999 ). One such mechanism
involves the association of the catalytic subunit of PP2A with a number
of regulatory B subunits. The B subunits themselves are targets of a
number of unrelated proteins that can associate with them and thus
influence PP2A activity. For example, an adenovirus protein, E4orf4,
has been shown to associate with PP2A through an interaction with the
PP2A-B subunit, PR55 . The resulting PP2A-E4orf4 complex is thought
to mediate the regulation of AP-1 transcriptional activity, which occurs during the late stage of viral infection (Kleinberger and Shenk,
1993 ). Similarly, a complex formed by two HIV-encoded proteins, NCp7
and Vpr, has been shown to bind to and activate the PP2A holoenzyme
containing the B subunit PR61 (Tung et al., 1997 ). Our data suggest a
novel mechanism of regulation of PP2A activity through the formation of
a receptor-enzyme complex involving the catalytic subunit of PP2A.
Formation of such a complex might be important in a variety of
signaling cascades involving PP2A.
 |
FOOTNOTES |
Received June 19, 2001; revised Aug. 7, 2001; accepted Aug. 8, 2001.
Part of this work was supported by Research Grants Council
Grants HKUST6100/98M and HKUST6135/99M. We thank Dr. G. Walter at the
University of California, San Diego, for the monoclonal antibody 6F9,
Dr. B. A. Hemmings at the Friedrich Miescher-Institute for the
PR65 and PR55 antibodies, Dr. J. S. Trimmer at the State University of New York in Stony Brook for the anti-NR3A antibody, Dr.
R. L. Huganir at the Howard Hughes Medical Institute, The John
Hopkins University School of Medicine, for the anti-phospho-NR1 antibodies, Dr. D. Krainc for the cDNA library, and Dr. M. Carles for
critical reading of this manuscript.
Correspondence should be addressed to Dr. Nikolaus J. Sucher,
Department of Biology, Hong Kong University of Science and Technology, Clear Water Bay, Kowloon, Hong Kong SAR, China. E-mail:
sucher{at}ust.hk.
 |
REFERENCES |
-
Bliss TV,
Collingridge GL
(1993)
A synaptic model of memory: long-term potentiation in the hippocampus.
Nature
361:31-39[Medline].
-
Ciabarra AM,
Sullivan JM,
Gahn LG,
Pecht G,
Heinemann S,
Sevarino KA
(1995)
Cloning and characterization of
-1: a developmentally regulated member of a novel class of the ionotropic glutamate receptor family.
J Neurosci
15:6498-6508[Abstract/Free Full Text]. -
Das S,
Sasaki YF,
Rothe T,
Premkumar LS,
Takasu M,
Crandall JE,
Dikkes P,
Conner DA,
Rayudu PV,
Cheung W,
Chen HS,
Lipton SA,
Nakanishi N
(1998)
Increased NMDA current and spine density in mice lacking the NMDA receptor subunit NR3A.
Nature
393:377-381[Medline].
-
Faux MC,
Scott JD
(1996)
More on target with protein phosphorylation: conferring specificity by location.
Trends Biochem Sci
21:312-315[Web of Science][Medline].
-
Fraser D,
Scott JD
(1999)
Modulation of ion channels: a "current" view of AKAPs.
Neuron
23:423-426[Web of Science][Medline].
-
Ho SN,
Hunt HD,
Horton RM,
Pullen JK,
Pease LR
(1989)
Site-directed mutagenesis by overlap extension using the polymerase chain reaction.
Gene
77:51-59[Web of Science][Medline].
-
Kennedy MB
(2000)
Signal-processing machines at the postsynaptic density.
Science
290:750-754[Abstract/Free Full Text].
-
Kleinberger T,
Shenk T
(1993)
Adenovirus E4orf4 protein binds to protein phosphatase 2A and the complex down regulates E1A-enhanced junB transcription.
J Virol
67:7556-7560[Abstract/Free Full Text].
-
Kremmer E,
Ohst K,
Kiefer J,
Brewis N,
Walter G
(1997)
Separation of PP2A core enzyme and holoenzyme with monoclonal antibodies against the regulatory A subunit: abundant expression of both forms in cells.
Mol Cell Biol
17:1692-1701[Abstract].
-
Kutsuwada T,
Kashiwabuchi N,
Mori H,
Sakimura K,
Kushiya E,
Araki K,
Meguro H,
Masaki H,
Kumanishi T,
Arakawa M,
Mishina M
(1992)
Molecular diversity of the NMDA receptor channel.
Nature
358:36-41[Medline].
-
Lee HK,
Kameyama K,
Huganir RL,
Bear MF
(1998)
NMDA induces long-term synaptic depression and dephosphorylation of the GluR1 subunit of AMPA receptors in hippocampus.
Neuron
21:1067-1078[Web of Science][Medline].
-
Lee HK,
Barbarosie M,
Kameyama K,
Bear MF,
Huganir RL
(2000)
Regulation of distinct AMPA receptor phosphorylation sites during bidirectional synaptic plasticity.
Nature
405:955-959[Medline].
-
Levitan IB
(1999)
Modulation of ion channels by protein phosphorylation. How the brain works.
Adv Second Messenger Phosphoprotein Res
33:3-22[Web of Science][Medline].
-
Lin XH,
Walter J,
Scheidtmann K,
Ohst K,
Newport J,
Walter G
(1998)
Protein phosphatase 2A is required for the initiation of chromosomal DNA replication.
Proc Natl Acad Sci USA
95:14693-14698[Abstract/Free Full Text].
-
McAllister AK,
Katz LC,
Lo DC
(1996)
Neurotrophin regulation of cortical dendritic growth requires activity.
Neuron
17:1057-1064[Web of Science][Medline].
-
Meguro H,
Mori H,
Araki K,
Kushiya E,
Kutsuwada T,
Yamazaki M,
Kumanishi T,
Arakawa M,
Sakimura K,
Mishina M
(1992)
Functional characterization of a heteromeric NMDA receptor channel expressed from cloned cDNAs.
Nature
357:70-74[Medline].
-
Monyer H,
Sprengel R,
Schoepfer R,
Herb A,
Higuchi M,
Lomeli H,
Burnashev N,
Sakmann B,
Seeburg PH
(1992)
Heteromeric NMDA receptors: molecular and functional distinction of subtypes.
Science
256:1217-1221[Abstract/Free Full Text].
-
Moriyoshi K,
Masu M,
Ishii T,
Shigemoto R,
Mizuno N,
Nakanishi S
(1991)
Molecular cloning and characterization of the rat NMDA receptor.
Nature
354:31-37[Medline].
-
Mulkey RM,
Herron CE,
Malenka RC
(1993)
An essential role for protein phosphatases in hippocampal long-term depression.
Science
261:1051-1055[Abstract/Free Full Text].
-
Mulkey RM,
Endo S,
Shenolikar S,
Malenka RC
(1994)
Involvement of a calcineurin/inhibitor-1 phosphatase cascade in hippocampal long-term depression.
Nature
369:486-488[Medline].
-
Mumby M
(1995)
Regulation by tumour antigens defines a role for PP2A in signal transduction.
Semin Cancer Biol
6:229-237[Web of Science][Medline].
-
Mumby MC,
Walter G
(1993)
Protein serine/threonine phosphatases: structure regulation and functions in cell growth.
Physiol Rev
73:673-699[Abstract/Free Full Text].
-
Pérez-Otaño I,
Schulteis CT,
Contractor A,
Lipton SA,
Trimmer JS,
Sucher NJ,
Heinemann SF
(2001)
Assembly with the NR1 subunit is required for surface expression of NR3A-containing NMDA receptors.
J Neurosci
21:1228-1237[Abstract/Free Full Text].
-
Price NE,
Mumby MC
(1999)
Brain protein serine/threonine phosphatases.
Curr Opin Neurobiol
9:336-342[Web of Science][Medline].
-
Roche KW,
Tingley WG,
Huganir RL
(1994)
Glutamate receptor phosphorylation and synaptic plasticity.
Curr Opin Neurobiol
4:383-388[Medline].
-
Rogers SW,
Hughes TE,
Hollmann M,
Gasic GP,
Deneris ES,
Heinemann S
(1991)
The characterization and localization of the glutamate receptor subunit GluR1 in the rat brain.
J Neurosci
11:2713-2724[Abstract].
-
Rose MD,
Winston F,
Hieter P
(1990)
In: Methods in yeast genetics: a laboratory course manual. Assay of
-galactosidase in yeast, pp 155-159. New York: Cold Spring Harbor Laboratory. -
Ruediger R,
Van Wart Hood JE,
Mumby M,
Walter G
(1991)
Constant expression and activity of protein phosphatase 2A in synchronized cells.
Mol Cell Biol
11:4282-4285[Abstract/Free Full Text].
-
Saito T,
Shima H,
Osawa Y,
Nagao M,
Hemmings BA,
Kishimoto T,
Hisanaga S
(1995)
Neurofilament-associated protein phosphatase 2A: its possible role in preserving neurofilaments in filamentous states.
Biochemistry
34:7376-7384[Medline].
-
Schonthal AH
(1995)
Regulation of gene expression by serine/threonine protein phosphatases.
Semin Cancer Biol
6:239-248[Web of Science][Medline].
-
Sheng M,
Pak DT
(1999)
Glutamate receptor anchoring proteins and the molecular organization of excitatory synapses.
Ann NY Acad Sci
868:483-493[Web of Science][Medline].
-
Smart TG
(1997)
Regulation of excitatory and inhibitory neurotransmitter-gated ion channels by protein phosphorylation.
Curr Opin Neurobiol
7:358-367[Web of Science][Medline].
-
Soderling TR,
Derkach VA
(2000)
Postsynaptic protein phosphorylation and LTP.
Trends Neurosci
23:75-80[Web of Science][Medline].
-
Sontag E,
Fedorov S,
Kamibayashi C,
Robbins D,
Cobb M,
Mumby M
(1993)
The interaction of SV40 small tumor antigen with protein phosphatase 2A stimulates the map kinase pathway and induces cell proliferation.
Cell
75:887-897[Web of Science][Medline].
-
Sontag E,
Nunbhakdi-Craig V,
Lee G,
Bloom GS,
Mumby MC
(1996)
Regulation of the phosphorylation state and microtubule-binding activity of Tau by protein phosphatase 2A.
Neuron
17:1201-1207[Web of Science][Medline].
-
Strack S,
Westphal RS,
Colbran RJ,
Ebner FF,
Wadzinski BE
(1997)
Protein serine/threonine phosphatase 1 and 2A associate with and dephosphorylate neurofilaments.
Mol Brain Res
49:15-28[Medline].
-
Strack S,
Zaucha JA,
Ebner FF,
Colbran RJ,
Wadzinski BE
(1998)
Brain protein phosphatase 2A: developmental regulation and distinct cellular and subcellular localization by B subunits.
J Comp Neurol
392:515-527[Web of Science][Medline].
-
Sucher NJ,
Akbarian S,
Chi CL,
Leclerc CL,
Awobuluyi M,
Deitcher DL,
Wu MK,
Yuan JP,
Jones EG,
Lipton SA
(1995)
Developmental and regional expression pattern of a novel NMDA receptor-like subunit (NMDAR-L) in the rodent brain.
J Neurosci
15:6509-6520[Abstract/Free Full Text].
-
Swope SL,
Moss SI,
Raymond LA,
Huganir RL
(1999)
Regulation of ligand-gated ion channels by protein phosphorylation.
Adv Second Messenger Phosphoprotein Res
33:49-78[Web of Science][Medline].
-
Thiels E,
Norman ED,
Barrionuevo G,
Klann E
(1998)
Transient and persistent increases in protein phosphatase activity during long-term depression in the adult hippocampus in vivo.
Neuroscience
86:1023-1029[Web of Science][Medline].
-
Tingley WG,
Ehlers MD,
Kameyama K,
Doherty C,
Ptak JB,
Riley CT,
Huganir RL
(1997)
Characterization of protein kinase A and protein kinase C phosphorylation of the N-methyl-D-aspartate receptor NR1 subunit using phosphorylation site-specific antibodies.
J Biol Chem
272:5157-5166[Abstract/Free Full Text].
-
Tung HY,
De Rocquigny H,
Zhao LJ,
Cayla X,
Roques BP,
Ozon R
(1997)
Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
FEBS Lett
401:197-201[Web of Science][Medline].
-
Walaas SI,
Greengard P
(1991)
Protein phosphorylation and neuronal function.
Pharmacol Rev
43:299-349[Abstract].
-
Wang LY,
Orser BA,
Brautigan DL,
MacDonald JF
(1994)
Regulation of NMDA receptors in cultured hippocampal neurons by protein phosphatases 1 and 2A.
Nature
369:230-232[Medline].
-
Westphal RS,
Anderson KA,
Means AR,
Wadzinski BE
(1998)
A signaling complex of Ca2+-calmodulin-dependent protein kinase IV and protein phosphatase 2A.
Science
280:1258-1261[Abstract/Free Full Text].
-
Westphal RS,
Tavalin SJ,
Lin JW,
Alto NM,
Fraser ID,
Langeberg LK,
Sheng M,
Scott JD
(1999)
Regulation of NMDA receptors by an associated phosphatase-kinase signaling complex.
Science
285:93-96[Abstract/Free Full Text].
-
Woolley CS,
McEwen BS
(1994)
Estradiol regulates hippocampal dendritic spine density via an N-methyl-D-aspartate receptor-dependent mechanism.
J Neurosci
14:7680-7687[Abstract].
-
Woolley CS,
Weiland NG,
McEwen BS,
Schwartzkroin PA
(1997)
Estradiol increases the sensitivity of hippocampal CA1 pyramidal cells to NMDA receptor-mediated synaptic input: correlation with dendritic spine density.
J Neurosci
17:1848-1859[Abstract/Free Full Text].
-
Ziff EB
(1997)
Enlightening the postsynaptic density.
Neuron
19:1163-1174[Web of Science][Medline].
Copyright © 2001 Society for Neuroscience 0270-6474/01/21207985-08$05.00/0
This article has been cited by other articles:

|
 |

|
 |
 
M. A. Henson, A. C. Roberts, K. Salimi, S. Vadlamudi, R. M. Hamer, J. H. Gilmore, L. F. Jarskog, and B. D. Philpot
Developmental Regulation of the NMDA Receptor Subunits, NR3A and NR1, in Human Prefrontal Cortex
Cereb Cortex,
November 1, 2008;
18(11):
2560 - 2573.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
P. Maurice, A. M. Daulat, C. Broussard, J. Mozo, G. Clary, F. Hotellier, P. Chafey, J.-L. Guillaume, G. Ferry, J. A. Boutin, et al.
A Generic Approach for the Purification of Signaling Complexes That Specifically Interact with the Carboxyl-terminal Domain of G Protein-coupled Receptors
Mol. Cell. Proteomics,
August 1, 2008;
7(8):
1556 - 1569.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Allen, B. Fakler, J. Maylie, and J. P. Adelman
Organization and Regulation of Small Conductance Ca2+-activated K+ Channel Multiprotein Complexes
J. Neurosci.,
February 28, 2007;
27(9):
2369 - 2376.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. J. Crossthwaite, A. Ciruela, T. F. Rayner, and D. M. F. Cooper
A Direct Interaction between the N Terminus of Adenylyl Cyclase AC8 and the Catalytic Subunit of Protein Phosphatase 2A
Mol. Pharmacol.,
February 1, 2006;
69(2):
608 - 617.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Q. Luo, Y. Ding, K. Watson, J. Zhang, and G.-H. Fan
N-Methyl-D-aspartate Attenuates CXCR2-Mediated Neuroprotection through Enhancing the Receptor Phosphorylation and Blocking the Receptor Recycling
Mol. Pharmacol.,
August 1, 2005;
68(2):
528 - 537.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Launey, S. Endo, R. Sakai, J. Harano, and M. Ito
Protein phosphatase 2A inhibition induces cerebellar long-term depression and declustering of synaptic AMPA receptor
PNAS,
January 13, 2004;
101(2):
676 - 681.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
N. O. Dalby and I. Mody
Activation of NMDA Receptors in Rat Dentate Gyrus Granule Cells by Spontaneous and Evoked Transmitter Release
J Neurophysiol,
August 1, 2003;
90(2):
786 - 797.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
I. M. Mansuy
STEPping into Position: A New Player in the NMDA Receptor Game
Mol. Interv.,
September 1, 2002;
2(5):
282 - 284.
[Abstract]
[Full Text]
[PDF]
|
 |
|
|

|