 |
Previous Article | Next Article 
The Journal of Neuroscience, 2001, 21:RC191:1-7
RAPID COMMUNICATION
The Photopigment Melanopsin Is Exclusively Present in Pituitary
Adenylate Cyclase-Activating Polypeptide-Containing Retinal Ganglion
Cells of the Retinohypothalamic Tract
Jens
Hannibal,
Peter
Hindersson,
Sanne M.
Knudsen,
Birgitte
Georg, and
Jan
Fahrenkrug
Department of Clinical Biochemistry, Bispebjerg Hospital,
University of Copenhagen, DK-2400 Copenhagen, Denmark
 |
ABSTRACT |
Mammalian circadian rhythms generated in the hypothalamic
suprachiasmatic nuclei are entrained to the environmental
light/dark cycle via a monosynaptic pathway, the retinohypothalamic
tract (RHT). We have shown previously that retinal ganglion cells
containing pituitary adenylate cyclase-activating polypeptide (PACAP)
constitute the RHT. Light activates the RHT via unknown photoreceptors
different from the classical photoreceptors located in the outer
retina. Two types of photopigments, melanopsin and the cryptochromes
(CRY1 and CRY2), both of which are
located in the inner retina, have been suggested as "circadian
photopigments." In the present study, we cloned rat melanopsin
photopigment cDNA and produced a specific melanopsin antibody. Using
in situ hybridization histochemistry combined with
immunohistochemistry, we demonstrate that the distribution of
melanopsin was identical to that of the PACAP-containing retinal ganglion cells. Colocalization studies using the specific melanopsin antibody and/or cRNA probes in combination with PACAP immunostaining revealed that melanopsin was found exclusively in the PACAP-containing retinal ganglion cells located at the surface of somata and
dendrites. These data, in conjunction with published action spectra
analyses and work in retinally degenerated (rd/rd/cl)
mutant mice, suggest that melanopsin is a circadian photopigment
located in retinal ganglion cells projecting to the biological clock.
Key words:
colocalization; suprachiasmatic nucleus; circadian
rhythm; rat; immunohistochemistry; melanopsin antibodies
 |
INTRODUCTION |
Mammalian
circadian rhythms of behavior and physiology are generated by the
principal pacemaker located in the suprachiasmatic nucleus (SCN) of the
hypothalamus (Klein et al., 1991 ). Internal circadian time is
synchronized (entrained) by light-induced resetting (photoentrainment)
mechanisms via a monosynaptic pathway originating from a subset
of retinal ganglion cells, the retinohypothalamic tract (RHT)
(Moore and Lenn, 1972 ; Johnson et al., 1988 ; Levine et al.,
1991 ; Moore et al., 1995 ). The retinal ganglion cells constituting the RHT contain the neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) and glutamate (Hannibal et al.,
2000 , 2001a ). Both neurotransmitters are thought to play a role in
light entrainment of the clock, as indicated by phase-shifting capabilities on the endogenous rhythm via regulation of clock gene expression in the SCN (Ding et al., 1994 ; Hannibal et al., 1997 , 2001b ; von Gall et al., 1998 ; Chen et al., 1999 ; Harrington et
al., 1999 ; Kopp et al., 1999 ; Mintz et al., 1999 ; Nielsen
et al., 2001 ). Using c-fos immunoreactivity as a
marker for neuronal activation, we have shown recently that
PACAP-immunoreactive ganglion cells were activated by light during
subjective day and at time points during the night, when light is able
to phase shift the endogenous rhythm (Hannibal et al., 2001a ). The
photopigment involved in light activation of the RHT and its cellular
localization in the retina are unknown. Previous studies in retinally
degenerated mutant mice lacking rods (rd/rd) (Foster et al.,
1991 ) and both rods and cones (rdta/cl) (Freedman et
al., 1999 ) have demonstrated that the classical opsin-based
photoreceptor cells, rods and cones, are dispensable for the circadian
light response (for review, see von Schantz et al., 2000 ). Similarly,
many blind persons with no conscious perception of light exhibit normal
photic entrainment of the circadian rhythm (Czeisler et al., 1995 ). The
cryptochromes CRY1 and CRY2 have been suggested
as circadian photopigments (Miyamoto and Sancar, 1999 ). However,
knock-out mice lacking one or both of the CRYs adjust their
behavior in response to the light/dark photoperiod similar to wild-type
mice, indicating that these molecules are not necessary for photic
signaling to the brain (van der Horst et al., 1999 ; Vitaterna et
al., 1999 ). Recently, a new opsin named melanopsin was cloned
(Provencio et al., 2000 ). Melanopsin belongs to one of four opsins
expressed outside the photoreceptor layer of the retina; it is solely
expressed in the inner mouse retina located in a small population of
retinal ganglion cells and some displaced amacrine and displaced
ganglion cells.
Using PACAP as a marker for the RHT-projecting retinal ganglion cells
and using in situ hybridization combined with
immunohistochemistry, we show here that the distribution of melanopsin
mRNA and protein in the rat retina is identical to that of the
PACAP-containing retinal ganglion cells, and that melanopsin is
exclusively present in PACAP-immunoreactive cells.
 |
MATERIALS AND METHODS |
Animals and tissue preparation
Male Wistar rats (180-220 gm; n = 20) housed
under standard laboratory conditions in a 12 hr light/dark cycle with
access to food and water ad libitum were used in the study.
[Light was turned on at zeitgeber 0 (ZT0) and turned off at ZT12.]
Experiments were performed according to the principles of laboratory
animal care in Denmark (Publication No. 382; June 10, 1987). Because initial experiments showed the highest level of both PACAP and melanopsin at subjective day, animals were killed between ZT0 and ZT8.
Animals were decapitated and eyes were rapidly removed after marking
the most medial point of the cornea with ink to allow orientation of
the retina. After removal of the cornea and the anterior chamber, the
vitreous body was gently removed. The retinas located in
situ in the posterior chamber were fixed in Stefanini's fixative
(2% paraformaldehyde and 0.2% picric acid in 0.1 M sodium phosphate buffer, pH 7.2) for 12-24 hr
at 4°C, removed from the eyecup, transferred to cryoprotectant, and
stored at 20°C until they were processed for in situ
hybridization and immunohistochemistry as whole mounts according to
procedures described below. Eyeballs from additional animals were
sectioned rather than processed as whole mounts. In these cases,
sections (12 µm/section) were cut perpendicular to the long axis of
the eyeball to allow a determination of the laminar localization of
melanopsin and/or PACAP gene-expressing cells.
Cloning of the rat melanopsin cDNA
A 498 bp cDNA fragment of rat melanopsin was obtained from
purified total RNA extracted from rat retinas by reverse transcriptase (RT)-PCR using the following primers:
5'-GTCCTGCTAGGCGTCTTGGCT-TTAT-3' and 5'-GTACTTGGGGTGAGTGATGGCGTA-3'
(Sigma-Genosys Ltd., Cambridgeshire, UK). The product was cloned into
the pcDNA3.1/V5/His-TOPO vector (Invitrogen, Groningen, The
Netherlands) and sequenced.
The rat melanopsin cDNA fragment was localized in the coding region
covering transmembrane 4 to transmembrane 7. Comparison with the
published mouse sequence (Provencio et al., 2000 ) revealed that the rat
melanopsin has a deletion of an arginine corresponding to the 1016 bp
position in the mouse sequence.
In situ hybridization histochemistry
In vitro labeling of cRNA antisense and sense probes
was performed as described previously using
33P-UTP (Hannibal et al., 1997 ). The cDNA
templates were the above-mentioned melanopsin plasmid and a plasmid
containing rat PACAP cDNA (Hannibal et al., 1999 ). In situ
hybridization was performed using a previously published protocol with
slight modifications (Hannibal et al., 1997 ). Briefly, after treatment
in acetic anhydride, dehydration in 70% ethanol, and prehybridization
(2 hr), whole-mount retinas were hybridized with melanopsin and/or
PACAP cRNA probes, fragmented by incubation in hydrolysis buffer for 50 min at 60°C, and used at a concentration of 1 × 107 cpm/ml. After hybridization, washing,
RNase treatment, and a final washing, the radioactive labeled retinas
were either immunostained for PACAP (see below) or placed on
gelatin-coated slides, dried, emulsion dipped (Amersham, Copenhagen,
Denmark), and exposed for 2-3 weeks before being developed.
Hybridization was routinely performed in parallel using an antisense
and a sense probe on retinas from the same animal; no signal was
obtained using the sense probes.
Determination of the density of melanopsin- and PACAP-expressing
retinal ganglion cells
Determination of the number of retinal ganglion cells containing
melanopsin and PACAP mRNA was performed as described previously (Hannibal et al., 2001a ). Briefly, retinas from the same animal hybridized with melanopsin and/or PACAP probes were examined in a
430 × 340 µm square and images were grabbed via a Leica
(Cambridge, UK) DC200 camera using Leica DC200 software. Images from
the central part of the upper and lower half of each retina were
analyzed (Fig.
1D,E,G,H) using
Leica QWin (version 2.2) software. Grayscale thresholds of the image
analysis system were established that identified specific melanopsin
and/or PACAP mRNA-containing cells. Positive cells with signals above
threshold from each section were then compiled and the number of
ganglion cells containing melanopsin and PACAP mRNA was determined.

View larger version (147K):
[in this window]
[in a new window]
|
Figure 1.
Melanopsin and PACAP expression in the rat retina.
In situ hybridization histochemistry on whole-mount rat
retinas using 33P-UTP-labeled cRNA probes for melanopsin
mRNA (A, D, G), PACAP mRNA (B, E,
H), and PACAP immunoreactivity (C, F,
I) demonstrate an identical distribution pattern for
melanopsin and PACAP located to a subset of retinal ganglion cells.
Higher magnification clearly showed a fourfold to fivefold higher
density of melanopsin- and PACAP-expressing retinal ganglion cells in
the superior half of the retina (D-F) compared
with the inferior half (G-I). Scale bars:
A-C, 1000 µm; D-I, 200 µm.
|
|
Immunohistochemistry
Melanopsin antibodies. A cDNA fragment encoding the
C-terminal predicted cytoplasmatic part of mouse melanopsin was
generated by RT-PCR. The cDNA was made from total RNA prepared from
mouse retinas using oligo(dT) primers and SuperScript (Life
Technologies, Taastrup, Denmark). The PCR was done
using the primers 5'-TCTTCATCTTCAGGGCCATC-3' and
5'-TTCTCTGCTGTAGGCCACATA-3' (Provencio et al., 2000 ) as well as
platinum Taq polymerase (Life Technologies). The PCR
fragment was cloned in pCRII-TOPO (Invitrogen). A clone containing 13 base mismatches was used as template for a second PCR using the primers 5'-CACCCCAAGTACAGGGTGGCCAT-3' and 5'-TTCTCTGCTGTAGGCCACATA-3'; the
fragment from this second PCR was subcloned in the vector pCRT7/NT-TOPO (Invitrogen) as described by the manufacturer. The sequence contained an open reading frame that represents 160 amino acid
residues (underlined) of the C-terminal cytoplasmatic part of mouse
melanopsin
(MRGSHHHHHHGMASMTGGQQMGRDL-YDDDD-KDPTLHPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWG TAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSSCRPMKGQGARPSSLRGDQKGRLAVCTGLSESPHSHTSQFPPCFPRG). The recombinant fusion protein was expressed in the host strain BL21(DE3)pLysS, extracted in Tris-equilibrated phenol, pH 8.0, and
precipitated with ethanol. The protein pellet was solubilized in 6 M guanidinium chloride, 0.1 M DTT, and 50 mM Tris, pH
8.0. The solubilized protein was passed over Sephadex G25 column
equilibrated with 5 mM mercapthoethanol, 8 M urea, 0.5 M NaCl, and 50 mM Tris, pH 8.0 (MUNT). Finally the His-tagged
recombinant fusion protein was captured on a Ni-nitrilotriacetic acid
Superflow column (Qiagen, Hilden, Germany); equilibrated with MUNT;
washed in 0.5 M NaCl and 50 mM Tris, pH 8.0; and eluted with 10 mM EDTA, 0.5 M NaCl, and 50 mM Tris, pH 8.0. Four rabbits were immunized with
50 µg of melanopsin fusion protein, dialyzed against 10 mM Tris and 0.15 M NaCl.
The immunization material was emulsified in an equal volume of complete
Freund's adjuvant for the first immunization and incomplete Freund's
adjuvant for the subsequent immunizations at 10 d intervals.
Rabbit serum (code no. 41K9, diluted 1:1000) drawn by venipuncture 5 weeks after the second immunization reacted with purified recombinant
protein (molecular mass of 28 kDa) in a Western blot performed
as described previously (Hindersson et al., 1987 ). The Western
blot antibody reactivity as well as immunostaining were removed by
absorption of the anti-melanopsin antiserum with the immunization material.
PACAP antibody. A previously characterized mouse monoclonal
antibody (code MabJHH1) directed against an epitope (amino acids 6-16)
that recognizes both PACAP-38 and PACAP-27 was used for PACAP
immunostaining (Hannibal et al., 1995 ). As a control,
preabsorption of the antibody with PACAP-38 (20 µg/ml) was performed,
which abolished all staining. Single- and double-antigen
immunohistochemistry for visualization of melanopsin and PACAP was
performed as described in detail previously (Fahrenkrug and Hannibal,
1998 ) using a mixture of biotinylated goat anti-mouse antiserum,
Cy2-conjugated donkey anti-rabbit antiserum (Jackson ImmunoResearch,
West Grove, PA), biotinylated tyramide (tyramide system amplification;
DuPont NEN, Boston, MA) and streptavidin-conjugated Texas Red.
Photomicrographs
Images were obtained via a Leica DC200 camera using Leica DC200
software; for double immunohistochemistry, an Olympus IX70 confocal
microscope equipped with Flouview v 2.1.39 (Olympus, Copenhagen,
Denmark) was used. Image-editing software (Adobe Photoshop and
Adobe Illustrator; Adobe Systems, San Jose, CA) was used to combine the obtained images into plates, and figures were printed on a
Tektronix (Wilsonville, OR) Phaser 450 dye sublimation printer.
 |
RESULTS |
Using in situ hybridization and immunohistochemistry,
melanopsin mRNA and protein were detected in a subset of retinal
ganglion cells distributed throughout the retina and in a few seemingly displaced ganglion or displaced amacrine cells located between the
ganglion cell layer and the inner nuclear cell layer (INL) (Figs. 1A,D,G, 2; also
see Fig. 4). However, the distribution pattern was not uniform, because
the density of ganglion cells containing melanopsin was in the range of
36-39 cells/mm2 in the superior half of
the retina and 5-9 cells/mm2 in the lower
half of the retina (Fig. 1D,G). The distribution of
melanopsin-containing cells was identical to the distribution of
retinal ganglion cells expressing PACAP mRNA. The density of the cells
containing PACAP mRNA ranged from 31 to 37 cells/mm2 in the superior half of the
retina and from 5 to 8 cells/mm2 in the
lower half of the retina (Fig. 1E,H). Because
an identical distribution of cells containing PACAP immunoreactivity
was observed (Fig. 1F,I), we investigated
whether melanopsin and PACAP were present in the same ganglion cells
using either melanopsin mRNA probes for in situ
hybridization histochemistry or the melanopsin antibody in combination
with PACAP immunostaining. Melanopsin was demonstrated exclusively in
the PACAP-containing retinal ganglion cells and in a few
PACAP-expressing displaced ganglion or displaced amacrine cells (Figs.
2-4). The
punctate melanopsin immunoreactivity was located at the surface of the
ganglion cell at soma and the dendritic processes (Fig. 4). Melanopsin
immunoreactivity could not be demonstrated in sections from the rat
brain (data not shown).

View larger version (104K):
[in this window]
[in a new window]
|
Figure 2.
Melanopsin is colocalized with PACAP in retinal
ganglion cells. A photomicrograph of melanopsin mRNA visualized by
33P-UTP labeled cRNA probes (A) and
PACAP immunostaining visualized by CY2 (B) on the
same whole-mount retina is shown. Individual retinal ganglion
cells are numbered, and each number indicates the same cells
in the two photomicrographs. Note that silver grains representing
melanopsin mRNA are also present in the PACAP-containing retinal
ganglion cells (B). Scale bars, 100 µm.
|
|

View larger version (157K):
[in this window]
[in a new window]
|
Figure 3.
Melanopsin is exclusively located in
PACAP-containing retinal ganglion cells. Confocal laser-scanning
photomicrographs show three randomly selected parts of the retina
double-immunostained for melanopsin (A, D, G), PACAP
(B, E, H), and melanopsin/PACAP (C, F,
I). Scale bar, 100 µm.
|
|

View larger version (39K):
[in this window]
[in a new window]
|
Figure 4.
Melanopsin is present in PACAP-immunoreactive
retinal ganglion cells and a few displaced ganglion/amacrine cells.
Confocal photomicrographs of cross sections of rat retinas showing
melanopsin (A, D), PACAP (B, E),
and melanopsin/PACAP (C, F) in a retinal ganglion
cell (A-C) and in a single displaced retinal
ganglion/amacrine cell. G, Confocal laser scanning
photomicrograph showing double-immunostaining of melanopsin
(green) and PACAP (red) in the same
ganglion cells of whole-mount retinas. Note the punctate melanopsin
immunoreactivity on the surface of the cell body and the processes. The
inset shows high magnification of a
melanopsin/PACAP-containing dendrite. GCL, Ganglion cell
layer. Scale bars: A-F, 50 µm; G, 20 µm.
|
|
 |
DISCUSSION |
In mammals, light entrainment of the clock is dependent on ocular
light perception (Nelson and Zucker, 1981 ). However, mice lacking the
classical rod and cone photoreceptors (rdta/cl mice) are
still able to entrain to a light/dark cycle (Freedman et al., 1999 ;
Lucas et al., 1999 ), suggesting that unidentified photoreceptors located in other parts of the retina are responsible for light entrainment of the circadian rhythm (Lucas and Foster, 1999 ). Our
finding that melanopsin is located exclusively in the PACAP-containing retinal ganglion cells constituting the RHT (Hannibal et al., 2001a )
supports the existence of a "non-image-forming" visual pathway to
the circadian system and makes melanopsin a candidate as a circadian
photopigment. Additional support for this notion comes from an
electrophysiological study on a flat-mount preparation of rat retina
in vitro that demonstrated that SCN-projecting ganglion cells, in contrast to conventional ganglion cells, responded to light
regardless of chemical blocking of synapses (Berson et al., 2001 ).
Furthermore, the light response was not attributable to electrical coupling to rods and cones because the SCN projecting ganglion cells were depolarizing, not hyperpolarizing as the in rods
and cones, suggesting that the phototransduction occurs within these
retinal ganglion cells themselves. Another interesting observation of
the present study was that the localization of melanopsin
immunoreactivity was restricted to the membrane of the cell soma and to
processes within the retina but not to processes in the optic nerve or
in the brain. This localization increases the light-perceiving
surface of the ganglion cells projecting to the SCN and may increase
their sensitivity to light stimulation.
The melanopsin photopigment is located in ganglion cells
constituting the RHT
As reported for melanopsin mRNA in mice (Provencio et al., 2000 ),
we found that melanopsin (mRNA and protein) in the rat was only present
in a subset of retinal ganglion cells and in a few displaced amacrine
or displaced ganglion cells; this finding agrees with the proposed
localization in the inner retina of a specific "circadian"
photoreceptor (Freedman et al., 1999 ; von Schantz et al., 2000 ).
The expression of melanopsin in PACAP-containing retinal ganglion cells
was demonstrated by a combination of in situ hybridization
histochemistry/immunohistochemistry and by double immunohistochemistry.
The number of retinal ganglion cells constituting the RHT is much
higher in rats (Moore et al., 1995 ; Hannibal et al., 2001a ) than in
mice (Provencio et al., 1998a ); however, of greater interest is the
demonstration that the density of SCN-projecting cells was four- to
fivefold higher in the superior than in the inferior retina. At present
we have no explanation for this uneven distribution, but dopamine,
which is a circadian transmitter of the retina, is located by a group
of amacrine and displaced amacrine cells that also show a
superior-inferior difference in density in the retina (Versaux-Botteri
et al., 1986 ). Whether there is any relationship between these amacrine
cells and the melanopsin/PACAP-containing cells remains to be investigated.
Action spectra analysis of possible circadian photopigments
Using action spectrum analysis for light entrainment of locomotor
activity in mammals, it has been reported that the light-sensitive material responsible for circadian photoentrainment could be an opsin-based photopigment with an absorption peak of ~500 nm
(Takahashi et al., 1984 ; Provencio and Foster, 1995 ). However, in a
recent study in humans, a photopigment with an absorption maximum close to 480 nm seemed to be involved in light-induced suppression of melatonin at night (Brainard et al., 2001 ). In blind
rd/rd/cl mice that are able to entrain to a light/dark
cycle, a photopigment with an absorption peak of 480 nm has been shown
to mediate the pupillary light reflex (Lucas et al., 2001 ). A possible
explanation for the observation described above could be the existence
of at least two photopigments, one mediating pupillary reflex and melatonin suppression and one that is responsible for light entrainment of locomotor activity. To further clarify the role of melanopsin in
circadian photoentrainment, the absorption peak needs to be determined.
In contrast to melanopsin, the vitamin B2-based
CRY1 and CRY2, which are present in a large
number of retinal ganglion cells and in unidentified cells of the inner
nuclear cell layer (Miyamoto and Sancar, 1998 ; Sancar, 2000 ), have
absorption maxima close to 420 nm (Miyamoto and Sancar, 1998 ), making
them less likely as circadian photoreceptors. This notion is supported
by studies in mCRY-deficient mice
(mCRY1 / ;
mCRY2 / ) demonstrating that
although the mCRYs are important components of the molecular
clock in the SCN, they are not essential for transmitting light
information to the SCN (Vitaterna et al., 1999 ). However, a role for
the CRYs in light perception to the clock has been suggested
recently. Triple-mutant mice lacking both CRYs, rods, and cones
(rd /rd ,
mCRY1 / ,
mCRY2 / ) were found to have lost
the ability to adjust their behavioral rhythm to a 12 hr light/dark
cycle, in contrast to their littermate controls
(rd/rd / ,
mCRY1 / , and
mCRY2 / mutant mice (Selby et
al., 2000 ). Whether the CRYs are directly photosensitive or
whether they participate in a signaling pathway downstream to another
photoreceptor like melanopsin is an open question.
Light activation of the retinal ganglion cells of the RHT
The physiological properties of retinal ganglion cells of
the RHT in response to light stimulation have been studied using extracellular recordings (Pu, 2000 ). Morphologically, cat retinal ganglion cells characterized as non- , non- cells (Pu, 1999 ) resemble the melanopsin/PACAP-containing retinal ganglion cells of the
rat in terms of their size and number of dendritic processes (Hannibal
et al., 1997 , 2000 , 2001a ). The recordings are characterized by a
sustained "on" response to light lasting as long as light is turned
on and peaking at 500 nm (Pu, 2000 ). We have shown recently that
c-fos expression is induced by white light in the
PACAP-containing retinal ganglion cells and that Fos immunoreactivity
is sustained only in the PACAP-containing retinal ganglion cells as
long as light is turned on (Hannibal et al., 2001a ). The presence of
melanopsin on the PACAP-containing retinal ganglion cells suggests that
the light-on response is attributable to activation of the melanopsin photopigment, possibly via a signaling pathway coupled to G-protein, and is regulated by kinases (Provencio et al., 1998b ).
Is PACAP an intraretinal transmitter?
In addition to innervation of the SCN, PACAP-immunoreactive
processes branch to the inner plexiform layer and INL
(Hannibal et al., 2000 ). Furthermore, the PACAP-specific
PAC1 receptor is expressed in the INL of the rat retina
(Seki et al., 1997 ). Thus, it is possible that light information
received by the PACAP-containing retinal ganglion cells could be
transmitted to other retinal cells, and it is tempting speculate that
the peptide may participate in the entrainment of the "retinal
circadian clock" expressing many of the recently identified clock
genes (King and Takahashi, 2000 ). In contrast, the
melanopsin/PACAP-containing cells may receive inputs from other retinal neurons.
In conclusion, our data, in conjunction with published action spectra
analyses and work in retinally degenerated (rd/rd/cl) mutant mice, suggest that melanopsin is a circadian photoreceptor located in PACAP-containing retinal ganglion cells projecting to the
biological clock.
 |
FOOTNOTES |
Received June 21, 2001; revised Sept. 28, 2001; accepted Oct. 1, 2001.
This study was supported by The Danish Biotechnology Center for
Cellular Communication and The Danish Neuroscience Programme. J.H.
received postdoctoral funding from Danish Medical Research Council
Grant 0001716. The skillful technical assistance of Lea Larsen,
Juliano Olsen, and Anita Hansen is gratefully acknowledged.
Correspondence should be addressed to Dr. Jens Hannibal, Department of
Clinical Biochemistry, Bispebjerg Hospital, Bispebjerg Bakke 23, DK-2400 Copenhagen NV, Denmark. E-mail: J.Hannibal{at}inet.uni2.dk.
This article is published in
The Journal of Neuroscience, Rapid Communications Section,
which publishes brief, peer-reviewed papers online, not in print. Rapid
Communications are posted online approximately one month earlier than
they would appear if printed. They are listed in the Table of Contents
of the next open issue of JNeurosci. Cite this article as:
JNeurosci, 2001, 21:RC191 (1-7). The
publication date is the date of posting online at
www.jneurosci.org.
 |
REFERENCES |
-
Berson DM,
Dunn EA,
Takao M
(2001)
Phototransduction by ganglion cells innervating the circadian pacemaker.
Invest Ophthalmol Vis Sci
42:S113.
-
Brainard GC,
Hanifin JP,
Greeson JM,
Byrne B,
Glickman G,
Gerner E,
Rollag MD
(2001)
Action spectrum for melatonin regulation in humans: evidence for a novel circadian photoreceptor.
J Neurosci
21:6405-6412.
-
Chen D,
Buchanan GF,
Ding JM,
Hannibal J,
Gillette MU
(1999)
PACAP: a pivotal modulator of glutamatergic regulation of the suprachiasmatic circadian clock.
Proc Natl Acad Sci USA
96:13409-13414.
-
Czeisler CA,
Shanahan TL,
Klerman EB,
Martens H,
Brotman DJ,
Emens JS,
Klein T,
Rizzo JF
(1995)
Suppression of melatonin secretion in some blind patients by exposure to bright light.
N Engl J Med
332:6-11.
-
Ding JM,
Chen D,
Weber ET,
Faiman LE,
Rea MA,
Gillette MU
(1994)
Resetting the biological clock: mediation of nocturnal circadian shifts by glutamate and NO.
Science
266:1713-1717.
-
Fahrenkrug J,
Hannibal J
(1998)
PACAP immunoreactivity in capsaicin-sensitive nerve fibres supplying the rat urinary tract.
Neuroscience
83:1261-1272.
-
Foster RG,
Provencio I,
Hudson D,
Fiske S,
De Grip W,
Menaker M
(1991)
Circadian photoreception in the retinally degenerate mouse (rd/rd).
J Comp Physiol [A]
169:39-50.
-
Freedman MS,
Lucas RJ,
Soni B,
von Schantz M,
Muñoz M,
David-Gray Z,
Foster RG
(1999)
Regulation of mammalian circadian behavior by non-rod, non-cone, ocular photoreceptors.
Science
284:502-504.
-
Hannibal J,
Mikkelsen JD,
Clausen H,
Holst JJ,
Wulff BS,
Fahrenkrug J
(1995)
Gene expression of pituitary adenylate cyclase activating polypeptide (PACAP) in the rat hypothalamus.
Regul Pept
55:133-148.
-
Hannibal J,
Ding JM,
Chen D,
Gillette MU,
Fahrenkrug J,
Larsen PJ,
Mikkelsen JD
(1997)
Pituitary adenylate cyclase activating peptide (PACAP) in the retinohypothalamic tract. A daytime regulator of the biological clock.
J Neurosci
17:2637-2644.
-
Hannibal J,
Jessop D,
Harbuz MS,
Fahrenkrug J,
Larsen PJ
(1999)
PACAP gene expression in neurons of the rat hypothalamo-pituitary-adrenocortical (HPA)-axis is induced by endotoxin and interleukin-1b.
Neuroendocrinology
70:73-82.
-
Hannibal J,
Moller M,
Ottersen OP,
Fahrenkrug J
(2000)
PACAP and glutamate are co-stored in the retinohypothalamic tract.
J Comp Neurol
418:147-155.
-
Hannibal J,
Vrang N,
Card JP,
Fahrenkrug J
(2001a)
Light-dependent induction of c-Fos during subjective day and night in PACAP containing retinal ganglion cells of the retino-hypothalamic tract.
J Biol Rhythms
16:457-470.
-
Hannibal J,
Brabet P,
Jamen F,
Nielsen HS,
Journot L,
Fahrenkrug J
(2001b)
Dissociation between light-induced phase shift of the circadian rhythm and clock gene expression in mice lacking the PACAP type 1 receptor (PAC1).
J Neurosci
21:4883-4890.
-
Harrington ME,
Hoque S,
Hall A,
Golombek D,
Biello S
(1999)
Pituitary adenylate cyclase activating peptide phase shifts circadian rhythms in a manner similar to light.
J Neurosci
19:6637-6642.
-
Hindersson P,
Knudsen JD,
Axelsen NH
(1987)
Cloning and expression of Treponema pallidum common antigen (Tp4): an antigen common to a wide range of bacteria.
J Gen Microbiol
133:587-596.
-
Johnson RF,
Moore RY,
Morin LP
(1998)
Loss of entrainment and anatomical plasticity after lesions of the hamster retinohypothalamic tract.
Brain Res
460:297-313.
-
King DP,
Takahashi JS
(2000)
Molecular genetics of circadian rhythms in mammals.
Annu Rev Neurosci
23:713-742.
-
Klein DC,
Moore RY,
Reppert SM
(1991)
In: Suprachiasmatic nucleus: the mind's clock. New York: Oxford UP.
-
Kopp M,
Schomerus C,
Dehghani F,
Korf HW,
Meissl H
(1999)
Pituitary adenylate cyclase activating polypeptide and melatonin in the suprachiasmatic nucleus: effects on the calcium signal transduction cascade.
J Neurosci
19:20619-219.
-
Levine JD,
Weiss ML,
Rosenwasser AM,
Miselis RR
(1991)
Retinohypothalamic tract in the female albino rat: a study using horseradish peroxidase conjugated to cholera toxin.
J Comp Neurol
306:344-360.
-
Lucas RJ,
Foster RG
(1999)
Photoentrainment in mammals: a role for cryptochrome?
J Biol Rhythms
14:4-10.
-
Lucas RJ,
Freedman MS,
Munoz M,
Garcia-Fernandez JM,
Foster RG
(1999)
Regulation of the mammalian pineal by non-rod, non-cone, ocular photoreceptors.
Science
284:505-507.
-
Lucas RJ,
Douglas RH,
Foster RG
(2001)
Characterization of an ocular photopigment capable of driving pupillary constriction in mice.
Nat Neurosci
4:621-626.
-
Mintz EM,
Marvel CL,
Gillespie CF,
Price KM,
Albers HE
(1999)
Activation of NMDA receptors in the suprachiasmatic nucleus produces light-like phase shifts of the circadian clock in vivo.
J Neurosci
19:5124-5130.
-
Miyamoto Y,
Sancar A
(1998)
Vitamin B2-based blue-light photoreceptors in the retinohypothalamic tract as the photoactive pigments for setting the circadian clock in mammals.
Proc Natl Acad Sci USA
95:6097-6102.
-
Miyamoto Y,
Sancar A
(1999)
Circadian regulation of cryptochrome genes in the mouse.
Brain Res Mol Brain Res
71:238-243.
-
Moore RY,
Lenn NJ
(1972)
A retinohypothalamic projection in the rat.
J Comp Neurol
146:1-14.
-
Moore RY,
Speh JC,
Card JP
(1995)
The retinohypothalamic tract originates from a distinct subset of retinal ganglion cells.
J Comp Neurol
352:351-366.
-
Nelson RJ,
Zucker I
(1981)
Absence of extraocular photoreception in diurnal and nocturnal rodents exposed to direct sunlight.
Comp Biochem Physiol A Physiol
69:145-148.
-
Nielsen HS,
Hannibal J,
Knudsen SM,
Fahrenkrug J
(2001)
Pituitary adenylate cyclase activating polypeptide induces period 1 and period 2 gene expression in the rat suprachiasmatic nucleus (SCN) during late night.
Neuroscience
103:433-441.
-
Provencio I,
Foster RG
(1995)
Circadian rhythms in mice can be regulated by photoreceptors with cone-like characteristics.
Brain Res
694:183-190.
-
Provencio I,
Cooper HM,
Foster RG
(1998a)
Retinal projections in mice with inherited retinal degeneration: implications for circadian photoentrainment.
J Comp Neurol
395:417-439.
-
Provencio I,
Jiang G,
De Grip WJ,
Hayes WP,
Rollag MD
(1998b)
Melanopsin: an opsin in melanophores, brain, and eye.
Proc Natl Acad Sci USA
95:340-345.
-
Provencio I,
Rodriguez IR,
Jiang G,
Hayes WP,
Moreira EF,
Rollag MD
(2000)
A novel human opsin in the inner retina.
J Neurosci
20:600-605.
-
Pu M
(1999)
Dendritic morphology of cat retinal ganglion cells projecting to suprachiasmatic nucleus.
J Comp Neurol
414:267-274.
-
Pu M
(2000)
Physiological response properties of cat retinal ganglion cells projecting to suprachiasmatic nucleus.
J Biol Rhythms
15:31-36.
-
Sancar A
(2000)
Cryptochrome: the second photoactive pigment in the eye and its role in circadian photoreception.
Annu Rev Biochem
69:31-67.
-
Seki T,
Shioda S,
Ogino D,
Nakai Y,
Arimura A,
Koide R
(1997)
Distribution and ultrastructural localization of a receptor for pituitary adenylate cyclase activating polypeptide and its mRNA in the rat retina.
Neurosci Lett
238:127-130.
-
Selby CP,
Thompson C,
Schmitz TM,
Van Gelder RN,
Sancar A
(2000)
Functional redundancy of cryptochromes and classical photoreceptors for nonvisual ocular photoreception in mice.
Proc Natl Acad Sci USA
97:14697-14702.
-
Takahashi JS,
DeCoursey PJ,
Bauman L,
Menaker M
(1984)
Spectral sensitivity of a novel photoreceptive system mediating entrainment of mammalian circadian rhythms.
Nature
308:186-188.
-
van der Horst GT,
Muijtjens M,
Kobayashi K,
Takano R,
Kanno S,
Takao M,
de Wit J,
Verkerk A,
Eker AP,
van Leenen D,
Buijs R,
Bootsma D,
Hoeijmakers JH,
Yasui A
(1999)
Mammalian Cry1 and Cry2 are essential for maintenance of circadian rhythms.
Nature
398:627-630.
-
Versaux-Botteri C,
Martin-Martinelli E,
Nguyen-Legros J,
Geffard M,
Vigny A,
Denoroy L
(1986)
Regional specialization of the rat retina: catecholamine-containing amacrine cell characterization and distribution.
J Comp Neurol
243:422-433.
-
Vitaterna MH,
Selby CP,
Todo T,
Niwa H,
Thompson C,
Fruechte EM,
Hitomi K,
Thresher RJ,
Ishikawa T,
Miyazaki J,
Takahashi JS,
Sancar A
(1999)
Differential regulation of mammalian period genes and circadian rhythmicity by cryptochromes 1 and 2.
Proc Natl Acad Sci USA
96:12114-12119.
-
von Gall C,
Duffield GE,
Hastings MH,
Kopp M,
Dehghani F,
Korf HW,
Stehle JH
(1998)
CREB in the mouse SCN: a molecular interface coding the phase-adjusting stimuli light, glutamate, PACAP, and melatonin for clockwork access.
J Neurosci
18:10389-10397.
-
von Schantz M,
Provencio I,
Foster RG
(2000)
Recent developments in circadian photoreception: more than meets the eye.
Invest Ophthalmol Vis Sci
41:1605-1607.
Copyright © Society for Neuroscience 0270-6474//$05.00/0
This article has been cited by other articles:

|
 |

|
 |
 
S. Weng, K. Y. Wong, and D. M. Berson
Circadian Modulation of Melanopsin-Driven Light Response in Rat Ganglion-Cell Photoreceptors
J Biol Rhythms,
October 1, 2009;
24(5):
391 - 402.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Y. Wong, F. A. Dunn, D. M. Graham, and D. M. Berson
Synaptic influences on rat ganglion-cell photoreceptors
J. Physiol.,
July 1, 2007;
582(1):
279 - 296.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. E. Doyle, A. M. Castrucci, M. McCall, I. Provencio, and M. Menaker
From the Cover: Nonvisual light responses in the Rpe65 knockout mouse: Rod loss restores sensitivity to the melanopsin system
PNAS,
July 5, 2006;
103(27):
10432 - 10437.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. S. Li, B.-Y. Chen, D. K. Tay, H. H. L. Chan, M.-L. Pu, and K.-F. So
Melanopsin-expressing retinal ganglion cells are more injury-resistant in a chronic ocular hypertension model.
Invest. Ophthalmol. Vis. Sci.,
July 1, 2006;
47(7):
2951 - 2958.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Munch, S. Kobialka, R. Steiner, P. Oelhafen, A. Wirz-Justice, and C. Cajochen
Wavelength-dependent effects of evening light exposure on sleep architecture and sleep EEG power density in men
Am J Physiol Regulatory Integrative Comp Physiol,
May 1, 2006;
290(5):
R1421 - R1428.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
O. Dkhissi-Benyahya, C. Rieux, R. A. Hut, and H. M. Cooper
Immunohistochemical evidence of a melanopsin cone in human retina.
Invest. Ophthalmol. Vis. Sci.,
April 1, 2006;
47(4):
1636 - 1641.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. L. S. Lindegaard, G. Olivecrona, C. Christoffersen, D. Kratky, J. Hannibal, B. L. Petersen, R. Zechner, P. Damm, and L. B. Nielsen
Endothelial and lipoprotein lipases in human and mouse placenta
J. Lipid Res.,
November 1, 2005;
46(11):
2339 - 2346.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
G. Q. Butcher, B. Lee, H.-Y. M. Cheng, and K. Obrietan
Light Stimulates MSK1 Activation in the Suprachiasmatic Nucleus via a PACAP-ERK/MAP Kinase-Dependent Mechanism
J. Neurosci.,
June 1, 2005;
25(22):
5305 - 5313.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Panda, S. K. Nayak, B. Campo, J. R. Walker, J. B. Hogenesch, and T. Jegla
Illumination of the Melanopsin Signaling Pathway
Science,
January 28, 2005;
307(5709):
600 - 604.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
C. S. Colwell, S. Michel, J. Itri, W. Rodriguez, J. Tam, V. Lelievre, Z. Hu, and J. A. Waschek
Selective deficits in the circadian light response in mice lacking PACAP
Am J Physiol Regulatory Integrative Comp Physiol,
November 1, 2004;
287(5):
R1194 - R1201.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Sakamoto, C. Liu, and G. Tosini
Classical Photoreceptors Regulate Melanopsin mRNA Levels in the Rat Retina
J. Neurosci.,
October 27, 2004;
24(43):
9693 - 9697.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. He, W. Dong, Q. Deng, S. Weng, and W. Sun
Seeing More Clearly: Recent Advances in Understanding Retinal Circuitry
Science,
October 17, 2003;
302(5644):
408 - 411.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. J. Gooley, J. Lu, D. Fischer, and C. B. Saper
A Broad Role for Melanopsin in Nonvisual Photoreception
J. Neurosci.,
August 6, 2003;
23(18):
7093 - 7106.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. D. Rollag, D. M. Berson, and I. Provencio
Melanopsin, Ganglion-Cell Photoreceptors, and Mammalian Photoentrainment
J Biol Rhythms,
June 1, 2003;
18(3):
227 - 234.
[Abstract]
[PDF]
|
 |
|

|
 |

|
 |
 
I. H. Kavakli and A. Sancar
Circadian Photoreception in Humans and Mice
Mol. Interv.,
December 1, 2002;
2(8):
484 - 492.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. Wee, A. M. Castrucci, I. Provencio, L. Gan, and R. N. Van Gelder
Loss of Photic Entrainment and Altered Free-Running Circadian Rhythms in math5-/- Mice
J. Neurosci.,
December 1, 2002;
22(23):
10427 - 10433.
[Abstract]
[Full Text]
[PDF]
|
 |
|
|

|