The Journal of Neuroscience, June 1, 2003, 23(11):4577-4589
Previous Article | Next Article 
The Distribution of Calcium Buffering Proteins in the Turtle Cochlea
Carole M. Hackney,1
Shanthini Mahendrasingam,1
Eugenia M. C. Jones,2 and
Robert Fettiplace2
1 MacKay Institute of Communication and Neuroscience, School of Life Sciences,
Keele University, Keele, Staffordshire ST5 5BG, United Kingdom, and
2 Department of Physiology, University of Wisconsin Medical School, Madison,
Wisconsin 53706
 |
Abstract
|
|---|
Hair cells of the inner ear contain high concentrations of calcium-binding
proteins that limit calcium signals and prevent cross talk between different
signaling pathways during auditory transduction. Using light microscope
immunofluorescence and post-embedding immunogold labeling in the electron
microscope, we characterized the distribution of three calcium-buffering
proteins in the turtle cochlea. Both calbindin-D28k and parvalbumin-
were confined to hair cells in which they showed a similar distribution,
whereas calretinin was present mainly in hair-cell nuclei but also occurred in
supporting cells and nerve fibers. The hair-cell concentration of
calbindin-D28k but not of parvalbumin-
increased from the low- to
high-frequency end of the cochlea. Calibration against standards containing
known amounts of calcium-buffering protein processed in the same fluid drop as
the cochlear sections gave cytoplasmic concentrations of calbindin-D28k as
0.130.63 mM and parvalbumin-
as
0.25
mM, but calretinin was an order of magnitude less. Total amount of
Ca 2+-binding sites on the proteins is at least 1.0 mM
in low-frequency hair cells and 3.0 mM in high-frequency cells.
Reverse transcription-PCR showed that mRNA for all three proteins was
expressed in turtle hair cells. We suggest that calbindin-D28k and
parvalbumin-
may serve as endogenous mobile calcium buffers, but the
predominantly nuclear location of calretinin argues for another role in
calcium signaling. The results support conclusions from electrophysiological
measurements that millimolar concentrations of endogenous calcium buffers are
present in turtle hair cells. Parvalbumin-
was also found in both inner
and outer hair cells of the guinea pig cochlea.
Key words: cochlea; calcium buffers; calbindin-D28k; calretinin; hair cells; immunocytochemistry; post-embedding labeling; parvalbumin
 |
Introduction
|
|---|
Cytoplasmic calcium regulates multiple fast events related to transduction
in auditory hair cells, including adaptation of mechanotransducer channels
(Assad et al., 1989
;
Crawford et al., 1989
), gating
of Ca 2+-activated K+ channels
(Art and Fettiplace, 1987
;
Roberts et al., 1990
), and
neurotransmitter release (Parsons et al.,
1994
; Moser and Beutner,
2000
). Each calcium-dependent process is sensitive to the amount
of calcium buffer (e.g., BAPTA) in the intracellular solution. Comparison of
results with exogenous buffers with those using perforated-patch recordings,
in which soluble proteins are not eluted from the cytoplasm, was used to
estimate the concentration of the native mobile calcium buffer of the hair
cell (Roberts 1993
;
Tucker and Fettiplace, 1996
).
In turtle auditory hair cells, this buffer is equivalent to 0.10.4
mM BAPTA and has similar concentrations in the hair bundle and cell
body but changes with the characteristic frequency (CF) of the cell (Ricci et
al., 1998
,
2000
). The variation probably
reflects differences in the size of the Ca 2+ influx via
mechanotransducer or voltage-dependent Ca 2+ channels, which both
increase in number with CF (Ricci and
Fettiplace, 1997
; Ricci et
al., 2000
). One function of the mobile buffer may be to limit the
spread of Ca 2+ and prevent cross talk between different signaling
pathways (Roberts, 1994
;
Hall et al., 1997
).
Although the identity of the endogenous calcium buffer in turtle hair cells
is unknown, several proteins thought to function as calcium buffers have been
found in the inner ears of other vertebrates. These include calbindin-D28k
(Dechesne and Thomasset, 1988
;
Oberholtzer et al., 1988
),
calretinin (Rogers 1989
;
Dechesne et al., 1991
), and
parvalbumin, which occurs in two forms: parvalbumin-
(Eybalin and Ripoll, 1990
) and
parvalbumin-
or oncomodulin
(Sakaguchi et al., 1998
;
Heller et al., 2002
). Each
protein has been reported to show a unique pattern of expression
(Pack and Slepecky, 1995
;
Baird et al., 1997
;
Edmonds et al., 2000
), often
restricted to one region of the hair-cell epithelium or one part of the cell.
No ultrastructural post-embedding labeling is available to confirm the
subcellular distribution for these proteins.
Electrophysiological measurements on turtle hair cells
(Ricci et al., 1998
) indicate
that the native calcium buffer, if it were calbindin-D28k, could have a
concentration of 0.52 mM. These values were derived from
equivalent BAPTA concentrations (0.10.4 mM) using
simulations of stereociliary calcium gradients, assuming that calbindin-D28k
has four Ca 2+ binding sites per molecule compared with one in
BAPTA but binds Ca 2+ 25 times more slowly. Immunocytochemical data
on the distribution of calcium-buffering proteins have not been quantified.
However, biochemical analysis of the chick cochlea gave a calbindin-D28k
concentration of
1 mM
(Oberholtzer et al., 1988
). By
quantifying immunoblots, the concentration of parvalbumin-3 in one type of
frog saccular hair cell was estimated as 3 mM, suggesting that it
is the dominant mobile buffer in these cells
(Heller et al., 2002
). In the
present study, quantitative immunogold labeling has been used to compare the
distributions of calbindin, calretinin, and parvalbumin along the turtle
cochlea and determine the relative abundance to assess their role in
cytoplasmic calcium buffering.
 |
Materials and Methods
|
|---|
Antibodies and purified proteins. Primary antibodies against the
calcium-binding proteins calbindin, calretinin, and parvalbumin were used in
this study. These included commercially available polyclonal antibodies to
recombinant rat calbindin-D28k and parvalbumin-
(SWant, Bellinzona,
Switzerland), a monoclonal antibody to human calretinin-22k (SWant), and a
polyclonal antibody to recombinant rat calretinin (Chemicon, Temecula, CA)
that recognizes both the calcium-bound and calcium-unbound versions of
calretinin in immunoblots. A polyclonal antibody to recombinant bullfrog
parvalbumin-3 (GenBank accession number AALO9922;
Heller et al., 2002
) was
kindly provided by Dr. S. Heller (Eaton Peabody Laboratory and Department of
Otolaryngology, Massachusetts General Hospital, Boston, MA).
The secondary antibodies used for immunofluorescence labeling were goat
anti-rabbit IgG-FITC conjugate or goat anti-mouse-tetramethyl-rhodamine
isothiocyanate (TRITC) conjugate (Sigma, Poole, UK). The secondary antibodies
used for transmission electron microscopy were 15 nm colloidal gold-conjugated
anti-rabbit and anti-mouse IgGs (British Biocell, Cardiff, UK). Purified
proteins were used for preadsorption controls. These included recombinant rat
calbindin-D28k, human calretinin (6-His-CR), and rat parvalbumin-
(SWant) and bullfrog parvalbumin-3 provided by Dr. Heller. The
"parvalbumin-3" nomenclature reflects the fact that the latter
protein most closely resembles CPV3, one of three parvalbumin-like proteins
first isolated from chick (Hapak et al.,
1994
). In other species, only two parvalbumins,
parvalbumin-
and parvalbumin-
, have been found so far (for
review, see Pauls et al.,
1996
). Parvalbumin-
is typically expressed in fast skeletal
muscle and in some GABAergic neurons. In mammals, parvalbumin-
has been
found in preimplantation embryos and in tumors from a variety of origins
(hence the term "oncomodulin"), as well as in the mammalian
cochlea. Chicken CPV3 displays strong sequence similarity to oncomodulin and
is thought to belong to the parvalbumin-
family
(Hapak et al., 1994
). Turtle
muscle is unusual in containing a parvalbumin belonging to the
sublineage (Maeda et al.,
1984
).
Animals. Most of the turtle cochleae (10) used in this study were
obtained and prepared as for related physiological studies
(Ricci and Fettiplace, 1997
).
Red-eared turtles (Trachemys scripta elegans; carapace length of
100125 mm) were decapitated, the head was split sagittally, and the
otic capsules were exposed using procedures approved by the Animal Care
Committee at the University of Wisconsin (protocol number A3368-01). The otic
capsule was opened, and the cochlea and lagena were dissected out and
incubated in saline (in mM: 125 NaCl, 4 KCl, 2.8 CaCl2,
2.2 MgCl2, 2 Na pyruvate, 8 glucose, and 10 Na-HEPES, pH 7.6)
containing up to 0.06 mg/ml protease (type XXIV; Sigma, St. Louis, MO) for 20
min. The tectorial membrane was then removed to expose the hair bundles, the
point at which physiological recordings are normally made from hair cells.
Here, the preparations were instead placed in 4% paraformaldehyde in 0.1
M sodium phosphate buffer (PB), pH 7.4, for 2 hr at room
temperature. They were then stored in 0.4% paraformaldehydePB at
4°C until being processed further for either light microscope
immunohistochemistry or for transmission electron microscopy. Four additional
cochleae were prepared using a more rapid fixation technique to improve the
preservation of the afferent nerve terminals at the bases of the hair cells.
For this, two turtles were decapitated, the otic capsules were opened, and the
half-head was immediately perfused with fixative. After being immersed in
fixative for 2 hr, the half-head was washed in phosphate buffer, and the
cochlea was dissected out as before.
Parvalbumin-3 distribution was also characterized in mammalian cochlear
hair cells. These experiments were performed on sections of guinea pig
cochleae, prepared as described previously
(Mahendrasingam et al., 1997
).
A guinea pig was killed with an overdose of sodium pento-barbital (Pentoject;
100 mg/kg, i.p.) and decapitated, the bulla was removed, and the cochleae were
exposed. The cochleae were perfused with 4% paraformaldehyde in PB via a small
hole in the apex and openings in the round and oval window at the base. They
were then immersed in fixative for 2 hr and washed in PBS, and the bone was
partially removed and dehydrated in a graded series of ethanols. They were
incubated in pure LR-White resin for 24 hr and then placed in a gelatin
capsule for polymerization of the resin at 50°C for 24 hr. Segments of the
organ of Corti were obtained by microslicing the embedded cochlea using a
diamond bladed circular saw, and ultrathin sections were cut onto nickel grids
and processed as for the turtle (see below).
Light microscope immunohistochemistry. Fixed turtle cochleae were
washed in 0.1 M PBS, pH 7.4, permeabilized with 0.5% Triton X-100
in PBS for 30 min, washed in PBS, blocked in 10% goat serum (GS) in PBS for 30
min, and incubated in primary antibody overnight at 4°C. The polyclonal
anti-calbindin-D28k and monoclonal and polyclonal anticalretinin antibodies
were diluted 1:500, and the polyclonal antiparvalbumin-3 antibody was diluted
1:10,000 in 1% bovine serum albumin (BSA) in PBS. They were then washed in 1%
BSAPBS, incubated in either goat anti-mouse or anti-rabbit IgG-FITC
conjugate diluted (1:20) in 1% BSAPBS for 2 hr, washed in 1%
BSAPBS and in PBS, and mounted in PBS on a cavity slide. Cochlear whole
mounts were examined under a 60x objective [Nikon (Tokyo, Japan) ELWD
Planfluor; numerical aperture, 0.7] using a Bio-Rad (Hemel Hempstead, UK)
MRC-1024ES laser scanning microscope system operating in confocal mode. A
series of z-sections was acquired at 2 or 4 µm intervals and superimposed
to generate a three-dimensional image stack.
To demonstrate the codistribution of two proteins, double-labeling
experiments were performed using two separate methods. To determine whether
calbindin-D28k and calretinin were colocalized, the cochlea was incubated
simultaneously in rabbit polyclonal anti-calbindin-D28k and mouse monoclonal
anti-calretinin after the appropriate permeabilization and blocking steps. It
was then washed in 1% BSAPBS, incubated in goat anti-rabbit IgG-FITC
and anti-mouse IgG-TRITC diluted (1:20) in 1% BSAPBS for 2 hr, and
washed in 1% BSAPBS before viewing. To examine colocalization of
calbindin-D28k and parvalbumin-3, a different approach was used because both
antibodies were polyclonals made in rabbit. In this case, the cochlea was
prepared as for a single antibody, either calbindin-D28k or parvalbumin-3, and
incubated in anti-rabbit IgG-FITC secondary antibody; the tissue was then
refixed in 4% paraformaldehyde in PB for 1 hr, washed thoroughly in PBS,
blocked, incubated in the other primary antibody, and labeled with anti-rabbit
IgG-TRITC secondary. To eliminate differential effects caused by refixation,
both experimental combinations were performed in which the tissue was treated
first with anti-calbindin-D28k and then with antiparvalbumin-3, or first with
anti-parvalbumin-3 and then with anti-calbindin-D28k.
Electron microscopy and immunogold labeling. Fixed turtle cochleae
were washed in 0.1 M phosphate buffer, pH 7.4, dehydrated in a
graded series of ethanols (70%, 15 min; 80%, 15 min; 90%, 15 min; and 100%, 15
min for two times), and infiltrated with LR-White resin (Agar Scientific,
Stansted, UK) at room temperature for 24 hr (four changes). Finally, the
cochleae were placed in pure resin in gelatin capsules that was polymerized at
50°C for 24 hr. Ultrathin (120 nm) longitudinal sections of the cochleae
were cut on a Leica (Milton Keynes, UK) Ultracut ultramicrotome and collected
on 200-mesh nickel grids. The grids were washed in 0.05 M
Tris-buffered saline (TBS), pH 7.4, and nonspecific protein binding was
blocked using 20% GS in TBS for 30 min. They were then incubated overnight at
4°C in the appropriate primary antibody diluted in TBS containing 1% BSA
as follows: polyclonal anti-calbindin-D28k, monoclonal anti-calretinin, and
polyclonal anti-calretinin (1:500), and polyclonal anti-parvalbumin-3
(1:50001:10,000). This was followed by washing in 1% BSATBS and
incubation in either goat anti-mouse IgG or anti-rabbit IgG conjugated to 15
nm gold diluted 1:20 in 1% BSATBS for 1 hr at room temperature. The
grids were washed again in TBS, followed by distilled water. The sections were
stained using 2% aqueous uranyl acetate for 20 min, followed by lead citrate
for 2 min and examined using a Jeol-100CX transmission electron microscope
(Jeol, Welwyn Garden City, UK) operated at an accelerating voltage of 100
kV.
Analysis of immunogold labeling densities. To determine the
density of gold labeling in different compartments of the cells along the
length of cochlea [from the high-frequency (HF) region to the low-frequency
(LF) region], micrographs were taken of the entire length of the epithelium
(1000x), and a montage was constructed. A random sampling method was
then used to count the number of gold particles in the different tissue
compartments. To count the number of gold particles in the cytoplasm of hair
cells and supporting cells, mitochondria-free areas were randomly selected at
low magnification (4800x) in which the gold particles were not visible.
The magnification was then increased (19,00048,000x) so that gold
particles could be counted within the same field of view on the transmission
electron microscope. The same method was used to determine the densities of
gold particles in the nucleus of hair cells. Scatter plots of gold particle
densities expressed as number of particles per square micrometer were
constructed using the positions that were mapped for sampling on the montage
along the length of the cochlea to provide the distance and the counts of gold
labeling.
Preadsorption controls. For negative controls for the antibodies
to calbindin-D28k and calretinin, 1 µl (1.43 µg) of the reconstituted
purified protein was added to 143 µl of the appropriate antibody solution
(1:500 dilution), mixed thoroughly, and incubated for 6 hr at 4°C on a
rotator. The procedure and concentrations used were as specified by the
protocol of the manufacturer SWant for adsorption in their product
description. For bullfrog parvalbumin-3, 10 µl (13 µg) of parvalbumin-3
was added to 130 µl of diluted (1:5000) anti-parvalbumin-3 solution. As a
negative control for parvalbumin-
, 1 µl (1 µg) of recombinant rat
muscle parvalbumin (parvalbumin-
) was added to 1 ml of diluted (1:5000)
anti-parvalbumin-3 solution. In each case, the preadsorbed antibody solution
was centrifuged for 10 min, and the supernatant was used in parallel with the
unadsorbed primary antibody. The primary antibody solution was treated in
exactly the same way (including centrifugation) as the preadsorbed antibody
solution.
Determination of hair-cell protein concentration. To establish the
concentration range of calbindin, calretinin, and parvalbumin in hair cells, a
calibration procedure was used similar to that devised previously for
determining glutamate concentrations in nerve terminals
(Storm-Mathisen and Ottersen,
1990
). A solution of each protein in 10% BSA in 4%
paraformaldehyde in PB was made, and the mixture was solidified into a gel by
the addition of 0.1% glutaraldehyde. A 12 mm block of each gel was
dehydrated and embedded in resin in the same manner as the tissue prepared for
transmission electron microscopy to provide a protein standard. Ultrathin
sections were then cut onto nickel grids from the standard and immunolabeled
with the relevant primary antibody and gold-conjugated secondary antibody
under the same conditions and in parallel with the labeling of a cochlear
sample. To ensure identical labeling conditions, both the standard and
cochlear sections were processed at the same time and in the same fluid drop.
In the first instance, to conserve scarce protein, gels were made with protein
concentrations of 15 µM. Within this range, the gold
particle count over the standard was proportional to protein concentration.
For calbindin-D28k, a later calibration was performed with a gel containing
225 µM of the protein. To determine the effect of the 0.1%
glutaraldehyde used to produce the standards on the efficiency of the antibody
labeling, a turtle cochlea fixed in 4% paraformaldehyde in the same manner as
those for the rest of the study was postfixed with 0.1% glutaraldehyde.
Sections from this cochlea were then immunolabeled for the relevant
calcium-binding protein at the same time as those from a specimen that had
been fixed using only paraformaldehyde. Immunogold counts were made from hair
cells at similar positions along the length of the cochlea, and the difference
in the immunolabeling level was calculated. With both calbindin-D28k and
parvalbumin-3, there was
2.5-fold reduction (2.45 ± 0.21;
n = 3) in label caused by glutaraldehyde. The effects of
glutaraldehyde on calretinin labeling was not determined because of the small
number of counts per cell but was assumed to be the same as that for
calbindin-D28k.
Immunoblots. Samples of fresh turtle hindbrain and cerebellum and
muscle were homogenized in HEPESEDTA buffer (in mM: 125
NaCl, 1 MgCl2, 25 NaHEPES, pH 7.4, 4 KCl, 5 glucose, and 2 NaEDTA)
containing protease inhibitors (1 µg/ml leupeptin and 0.5 µg/ml
pepstatin), and the homogenate was centrifuged at 3000 x g for
10 min. The pellet was resuspended in the homogenization buffer for later use,
and the supernatant was centrifuged at 35,000 x g for 30 min.
The supernatant was then collected, and the pellet was rinsed twice and
resuspended in homogenization buffer. The protein concentration in each of
these three fractions was determined using a modified Bradford assay. Each of
the protein samples was run on a 12% SDS-PAGE gel alongside recombinant
calbindin-D28k and calretinin (SWant), and the gel was transferred to
nitrocellulose. Twelve micrograms of total protein were loaded into each lane.
Blots were blocked in 3% BSA in TBS plus 0.05% Tween (TTBS) for 2 hr at room
temperature, followed by overnight incubation in primary antibody (1:1000) in
2% BSA in TTBS at 4°C. Blots were rinsed six times in TTBS and incubated
for 1 hr at room temperature in secondary antibody [1:50,000 HRP-conjugated
goat anti-rabbit antiserum (Vector Laboratories, Burlingame, CA) in 2% BSA in
TTBS]. They were again washed six times in TTBS for 10 min each, and the
antibody labeling was visualized using a chemiluminescent technique
(Super-Signal West Pico; Pierce, Rockford, IL) according to the instructions
of the manufacturer. Results with the SWant calbindin antiserum were not
altered significantly by preadsorption with recombinant calretinin. The
density of the bands on the gels was quantified with a GS670 Imaging
Densitometer (Bio-Rad).
To obtain additional quantitative information, immunoblots were performed
on turtle cochlear tissue. Turtle cochleae were dissected and trimmed to
remove residual pieces of the saccule and the ampulla of the posterior
semicircular canal and dissolved in 20 mM PB, pH 7.4, containing 5
mM EDTA and a protease inhibitor mixture (Complete; Roche
Diagnostics, Indianapolis, IN) and processed as described by Mahendrasingam et
al. (1998
). Tissue from seven
cochleae was collected in 15 µl of buffer solution, added to 15 µl of
sample buffer (62.5 mM Tris-HCl, pH 6.5, with 2% SDS, 5%
mercaptoethanol, 10% glycerol, and 0.001% bromophenol blue), and heated for 3
min at 100°C. Cochlear proteins were separated on a 12% polyacrylamide gel
aongside recombinant calbindin-D28k, calretinin, and parvalbumin-3 and then
electroblotted onto nitrocellulose. Blots were incubated with antibodies to
each of the three calcium-binding proteins (1:500 for calbindin-D28k and
calretinin; 1:5000 for parvalbumin-3), and bands labeled by the primary
antibody were visualized using a biotin extravidinperoxidase procedure
(Sigma). For a negative control for the turtle cochlea, primary antibody was
replaced with dilution buffer.
Expression of mRNA. For each of the calcium-binding proteins, the
mRNA expression in turtle hair cells was examined using a reverse
transcription (RT)-PCR technique. Degenerate primers were designed based on
the sequences for chicken calbindin-D28k and calretinin and were initially
used to amplify message from poly(A +) mRNA from turtle brain
(Jones et al., 1998
). The
sequences corresponded to amino acid residues 1015 (VEISAA) and
247252 (KLYRAE) for calbindin-D28k and residues 713 (PHLHLAE)
and 166172 (NGDGKLG) for calretinin. PCR products were subcloned and
then sequenced at the University of Wisconsin Biotechnology Center (Madison,
WI). Turtle-specific primers for the two proteins were constructed from the
nucleotide sequences derived from the brain products. The primers for
calbindin-D28k were as follows: 5'GAACTTCATCCAGGAGCTTC (forward) and
5'CCATTGCCATCTTGATCATAC (reverse). The primers for calretinin were as
follows: 5'CTACATTGAGGCAAGGAGCTGG (forward) and
5'GCAGCTTTGGCTCATCGTAGG (reverse).
These primers were used to amplify cDNA from hair cells isolated from the
turtle cochlea as described previously
(Jones et al., 1998
). After an
initial denaturation at 94°C for 120 sec, PCR conditions were as follows:
35 cycles of denaturation at 94°C for 45 sec, annealing at 56°C for 60
sec (calbindin-D28k) or 62°C for 60 sec (calretinin), and extension at
72°C for 120 sec, with a final extension for 10 min. The products obtained
were of the appropriate length (351 bp for calretinin and 501 bp for
calbindin-D28k) and gave the correct banding pattern when digested with
restriction enzymes (BamHI for calretinin and AflII and
EarI for calbindin-D28k) and size separated with PAGE.
An amino acid (but not a nucleotide) sequence was available for muscle
parvalbumin of the map turtle Graptemys geographica
(Maeda et al., 1984
; Swiss pro
P02614
[GenBank]
). Comparison with other parvalbumin sequences has indicated that the
turtle muscle parvalbumin belongs to the
lineage
(Maeda et al., 1984
).
Degenerate primers were constructed on the basis of conserved regions of the
aligned sequences of map turtle parvalbumin-
and bullfrog parvalbumin-3,
corresponding to amino acids 5160 (forward) and amino acids
95103 (reverse). The primers were as follows:
5'-GAT/CGAA/GGAT/CAAA/GTCIGGITTT/CATIGAA/GG (forward) and
5'-GA/GAAT/CTCA/GTCIACICCIATT/CTTICC (reverse).
These degenerate primers were used to amplify a 156 bp product related to
parvalbumin-
from muscle of the red-eared turtle. The deduced amino acid
sequence was as follows:
DQDKSGFMEEDELQLFLQNFSSTARALTAAETKAFMAAGTDGDGDGKIGVDEF. This is identical to
that portion of sequence (amino acid residues 52103) for the map turtle
parvalbumin-
. Specific primers were then built from the turtle muscle
cDNA: 5'-GATGAGCTTCAGCTGTTTCTG (forward) and
5'-GTCACCTGCAGCCATGAAAG (reverse).
The specific primers were used to amplify cDNA from turtle muscle,
cerebellum, and hair cells. Products were size separated by agarose gel
electrophoresis, blotted, and probed with 32P-labeled (156 bp) cDNA
cloned from turtle muscle. Products of the expected 92 bp size were seen in
all three turtle tissues, indicating that the same parvalbumin-
is
expressed in brain, muscle, and hair cells.
 |
Results
|
|---|
Hair-cell mRNA for calcium-binding proteins
Calbindin-D28k and calretinin were both cloned from turtle brain cDNA. For
calbindin-D28k, 243 of the 263 amino acid residues were identified (GenBank
accession number AF545849
[GenBank]
), giving a sequence that is 82% identical to the
equivalent region in human and rat. For calretinin, amino acid residues
7172 (of a total 269) were obtained (GenBank accession number
AY150212
[GenBank]
), the sequence being 91% identical to human and rat over a region to
which both monoclonal and polylconal antibodies to calretinin were made.
Turtle-specific primers were then used to show that message for both
calcium-binding proteins was expressed in turtle auditory hair cells. PCR
products obtained from hair cells were of the expected length and gave
fragments of the appropriate size when cut with restriction enzymes (see
Materials and Methods). The appearance of both calcium-binding proteins in the
inner ear was first shown for the chicken
(Rogers, 1989
). To demonstrate
that the human and rat polyclonal antibodies would recognize the
calcium-binding proteins in turtle, immunoblots were performed of material
isolated from turtle hindbrain, which was run in parallel with the relevant
recombinant proteins (Fig.
1A). Differential centrifugation of the brain tissue gave
three fractions corresponding to nucleus and mitochondria, cytoplasm, and
membrane. The intensity of the bands was used to show that, although a
majority of the label was in the cytoplasmic fraction, a significant
proportion of protein was also present in the nuclear and membrane fractions
(Fig. 1A). It should
be noted that densitometry of the bands on the immunoblots suggested that, at
the same antibody dilution (1:1000), the calretinin antibody was approximately
four times more effective than the calbindin-D28k antibody in labeling the
same amount of recombinant protein.

View larger version (25K):
[in this window]
[in a new window]
|
Figure 1. Immunoblots of turtle tissue with polyclonal calbindin-D28k, calretinin,
and parvalbumin-3 antibodies. A, Turtle hindbrain extractrun
alongside the respective recombinant protein on 7.5% polyacrylamide gels. The
three tissue lanes correspond to different cellular fractions obtained with
sequential 3000 and 35,000 - g centrifugation: nucleus and
mitochondria (3,000 x g pellet, 3k P), diffusible cytoplasmic
(35,000 x g supernatant, 35k S), and membrane (35,000 x
g pellet, 35k P). Although for both calbindin-D28k and calretinin the
largest label was in the diffusible cytoplasmic fraction, some label also
occurred in the other cell fractions. B, Turtle muscle and hindbrain
extract (35,000 x g supernatant) run on a 1020% gradient
polyacrylamide gel and labeled with antibody to parvalbumin-3. Forty times
more brain protein (mostly cerebellum) was loaded on the gel compared with
muscle protein. C, Turtle cochlear proteins run on a 12%
polyacrylamide gel alongside calbindin-D28k, calretinin, and parvalbumin-3.
For each pair of lanes, the left one contains protein from a single cochlea,
and the right one contains 10 ng of pure protein. The band for turtle
parvalbumin is at 11.5 kDa compared with 13 kDa for bullfrog
parvalbumin-3.
|
|
Degenerate primers were used to isolate a partial parvalbumin-
sequence from turtle muscle (GenBank accession number AY150848
[GenBank]
), which allowed
the construction of turtle-specific primers. These primers were used to
amplify a cDNA product of the correct size from turtle hair cells, and this
band could be labeled with parvalbumin-
cDNA. Thus, there is evidence
for expression of all three calcium-binding proteins calbindin-D28k,
calretinin, and parvalbumin in hair cells of the turtle cochlea. Immunoblots
were performed using protein isolated from turtle muscle and cerebellum, which
showed that the bullfrog parvalbumin-3 antibody recognized turtle proteins of
the appropriate size,
12 kDa (Fig.
1B). This is close to the reported molecular weight of
turtle parvalbumin-
, 11.6 kDa (Maeda
et al., 1984
).
The antibodies were also tested on immunoblots of turtle cochlear material
(Fig. 1C). By
comparing the intensities of the cochlear bands with the intensities of bands
for the pure proteins, we were able to estimate the amount of protein present
in the cochlea as 9.6 ng for calbindin-D28k, 13.7 ng for calretinin, and 4.9
ng for parvalbumin-3. To convert these amounts to concentrations, it is
necessary to assume the distribution of the protein and the size of the
compartment. As will be shown in the subsequent immunohistochemistry,
calbindin-D28k and parvalbumin-3 are both strictly localized to the hair
cells. To obtain a hair cell protein concentration, the cochlea is assumed to
comprise 1000 cylindrical hair cells 25 µm in length and 10 µm in
diameter (Hackney et al.,
1993
). These dimensions correspond to a cellular volume of 2 pl
(neglecting the stereociliary bundle), and the average protein concentrations
inferred are 0.17 mM for calbindin-D28k and 0.2 mM for
parvalbumin-3. Applying the same argument to calretinin implies a hair-cell
concentration of 0.22 mM. However, the immunohistochemistry
demonstrates that calretinin also occurs in supporting cells and auditory
nerve terminals (Fig. 2). If
calretinin were uniformly distributed in the sensory epithelium, which is 1000
µm long, 100 µm wide, and 60 µm deep
(Sneary, 1988
;
Hackney et al., 1993
), with a
total volume of 6 nl, the average cellular concentration would be 76
µM. This is still likely to be an overestimate because
calretinin is also present in the surrounding cells of the cochlear duct
(Fig. 2).

View larger version (74K):
[in this window]
[in a new window]
|
Figure 2. Immunofluorescence of turtle cochlear whole mounts labeled with antibodies
to calcium-binding proteins. A, Polyclonal (SWant) calbindin-D28k.
B, Polyclonal frog parvalbumin-3. C, Monoclonal (SWant)
calretinin. Each whole mount is a montage of five to seven images, acquired
with a 60x objective, and is oriented with the low-frequency end on the
right. The hooked region of the cochlea on the left represents hair cells on
the limbus that have different morphology to those on the basilar membrane
(Hackney et al., 1993 ). Note
that calbindin-D28k and parvalbumin-3 label the hair cells on basilar
membrane, but calretinin labels other cell types, including the nerve fibers
emanating from the papilla. For both calbindin-D28k and calretinin, the
immunofluorescence intensity increases from low- to high-frequency end.
|
|
Immunofluorescence in cochlear whole mounts
Antibodies to each of the three calcium-binding proteins produced labeling
throughout the turtle cochlea (Fig.
2). Within the auditory papilla, the main cell types are hair
cells, supporting cells, and afferent and efferent nerve fibers
(Sneary, 1988
). Antibodies to
calbindin-D28k labeled the hair cells but not the supporting cells. In
contrast, antibodies to calretinin labeled the hair cells most prominently but
also produced some signal in the surrounding supporting cells and in the nerve
fibers. The pattern of labeling with the antibody to parvalbumin-3 was similar
to that for calbindin-D28k, but no labeling was evident with the antibody to
parvalbumin-
. Calbindin-D28k and calretinin are
59% identical at
the amino acid level in chickens, and there is possible cross reactivity
(SWant product description) for the polyclonal anti-calbindin-D28k to
calretinin. Furthermore, a SWant monoclonal anti-calbindin-D28k was found to
be ineffective on both immunoblots of turtle brain tissue and on cochlear
sections. It was therefore important to perform preadsorption controls.
Preadsorption of anti-calbindin-D28k with calretinin had no effect on the
appearance of label in the hair cells, but preadsorption with calbindin-D28k
totally abolished the signal (data not shown). Similarly, preadsorption of the
monoclonal anti-calretinin with calbindin-D28k did not alter the pattern of
labeling. Preadsorption of anti-calretinin with calretinin abolished the
fluorescence in all cochlear cells, indicating that the diffuse fluorescence
in Figure 2C is not
background but rather reflects specific labeling. Other preadsorption
controls, particularly for parvalbumin, are reported later in presentation of
the electron microscopic data. These results support the notion that both
calbindin-D28k and calretinin are present in the cochlea. In preparations
labeled with calbindin-D28k and calretinin, but not with parvalbumin, there
was evidence for a gradient in the immunofluorescence from the low- to
high-frequency end of the cochlea (Fig.
2), suggesting a higher concentration of calcium buffer toward the
high-frequency end. Quantification of the immunofluorescence gradient is shown
for calbindin-D28k and calretinin in Figure
3.

View larger version (23K):
[in this window]
[in a new window]
|
Figure 3. Gradients of immunofluorescence for calcium-binding proteins in the turtle
cochlea. A, Calbindin-D28k; line is least-squares fit with r
= 0.76. B, Calretinin; line is least-squares fit with r =
0.78. In each plot, the ordinate denotes fluorescence intensity of pixels on a
line along the center of the papilla drawn from apex to base. The pixel size
was 3 x 3 µm and was less than the area of an individual hair cell or
supporting cell. For the calbindin-D28k plot, only hair-cell measurements are
shown as the immunofluorescence of the supporting cells was very small (see
Fig. 2 A). For the
calretinin plot, the immunofluorescence gradient reflects both hair cells and
supporting cells, which were comparably labeled
(Fig. 2C).
|
|
Double-labeling experiments were performed to determine whether the
different calcium-binding proteins were colocalized. These were most
straightforward in experiments in which different secondary antibodies could
be used: an anti-rabbit IgG-FITC for the polyclonal and anti-mouse IgG-TRITC
for the monoclonal. The results showed that the same set of hair cells labeled
with FITC-tagged anti-calbindin-D28k were also labeled with TRITC-tagged
anti-calretinin (Fig. 4
A). Superposition of the FITC and TRITC images produced
yellow staining of the hair cells on the basilar membrane, indicating the
presence of both proteins. Examining the codistribution of calbindin-D28k and
parvalbumin-3 was more complicated because both were labeled with rabbit
polyclonal antibodies. This necessitated refixing the tissue after incubating
with one primary and secondary combination before treating with the other
primary and secondary (see Materials and Methods). Similar results were
obtained whether anti-calbindin-D28k or anti-parvalbumin-3 was applied first,
and these showed that calbindin-D28k and parvalbumin-3 were also colocalized
to the same hair cells on the basilar membrane
(Fig. 4B).

View larger version (125K):
[in this window]
[in a new window]
|
Figure 4. Colocalization of calcium-binding proteins in turtle cochlear whole mounts
from double labeling with pairs of antibodies. A,
Calbindin-D28kcalretinin. Superimposed images of polyclonal
anti-calbindin-D28k FITC fluorescence and monoclonal anti-calretinin TRITC
fluorescence. Hair cells on the basilar membrane are labeled with both green
FITC and red TRITC. Note the red background between the hair cells, indicating
the presence only of calretinin in the supporting cells. B,
Calbindin-D28kparvalbumin-3. Superimposed images of polyclonal
anticalbindin-D28k FITC fluorescence and polyclonal anti-parvalbumin-3 TRITC
fluorescence. The cochlea was first treated with rabbit anti-calbindin-D28k
and incubated in anti-rabbit IgG-FITC secondary antibody; the tissue was then
refixed in 4% paraformaldehyde, incubated in antiparvalbumin-3, and labeled
with anti-rabbit IgG-TRITC secondary. Note the red hair cells at the
low-frequency end to the right, indicating a lower concentration of
calbindin-D28k. Similar images were obtained by first labeling with
anti-parvalbumin-3, refixing, and then labeling with anti-calbindin-D28k. Both
A and B are montages of six images acquired with 60x
objective.
|
|
Post-embedding immunogold labeling
High-resolution electron microscopy corroborated the cellular distribution
of the calcium-binding proteins inferred from the light microscopy. Labeling
for calbindin-D28k was confined to the hair cells (Figs.
5,
6) but was present for
calretinin in both hair cells and supporting cells
(Fig. 7). The calbindin-D28k
labeling was unaffected by preadsorbing the antibody with calretinin but was
completely abolished by preadsorbing with calbindin-D28k (data not shown). For
calretinin, both the monoclonal antibody (SWant) and the polyclonal antibody
(Chemicon) gave qualitatively similar results, but the latter produced a much
higher density of immunogold that was preferable for quantification. The
subcellular distribution of calbindin-D28k and calretinin within the hair
cells was quite different. Calbindin-D28k labeling was dispersed throughout
the cytoplasm, both above and below the nucleus, and was found in the
cuticular plate and stereocilia. In the latter, the labeling was often
stronger close to the plasma membrane (Fig.
6). Label was also found in the nucleus, in which it was slightly
greater than in the neighboring cytoplasm. The relative amounts in different
intracellular compartments were as follows: nucleus
cuticular plate >
apical cytoplasm, stereocilia.

View larger version (128K):
[in this window]
[in a new window]
|
Figure 5. Post-embedding immunogold labeling for calbindin-D28k in turtle auditory
papilla. A, Section through the apex of a hair cell (hc) and adjacent
supporting cells (sc). Note the labeling of the stereocilia (st), cuticular
plate (cp), and hair-cell cytoplasm but relative lack of labeling in the
mitochondria (examples at arrows) and adjacent supporting cells (sc).
B, Section through the basal region of a hair cell (hc) and adjacent
supporting cell (sc). Note labeling of the nucleus (nu), nucleolus (nc), and
hair-cell cytoplasm but lack of labeling in the mitochondria and adjacent
supporting cell (sc). Scale bar, 0.5 µm.
|
|

View larger version (110K):
[in this window]
[in a new window]
|
Figure 6. Immunogold labeling for calbindin-D28k in turtle hair bundle. Longitudinal
(A) and transverse (B) section of a hair bundle. Note that
labeling occurs in the stereocilia (st) and kinocilium (k) and that there is
some indication that stereociliary labeling is greatest toward their periphery
(arrowheads), although this is not apparent in all profiles. Scale bars, 0.5
µm.
|
|

View larger version (157K):
[in this window]
[in a new window]
|
Figure 7. Post-embedding immunogold labeling for calretinin in turtle auditory
papilla. A, Section through the apex of a hair cell (hc) and adjacent
supporting cells (sc). Note the labeling of the stereocilia (st), cuticular
plate (cp), and hair-cell cytoplasm but relative lack of labeling in the
mitochondria (examples at arrows). Also note labeling in the cytoplasm of
adjacent supporting cells (sc). B, Section through the basal region
of a hair cell (hc) and adjacent nerve terminal (nt). Note that the nucleus
(nu) is more heavily labeled than the hair-cell cytoplasm and note also the
lack of labeling in the mitochondria. The nerve terminal and supporting cell
(sc) are labeled. Scale bar, 0.5 µm.
|
|
For calretinin, there was a small amount of label in the cytoplasm, but
labeling was densest in the nucleus (Fig.
7). There was also a suggestion of specific localization to the
apical membrane. Nerve terminals at the base of the hair cells were also
labeled.
The pattern of labeling for parvalbumin-3 was very similar to that for
calbindin-D28k and was confined to the hair cells, with higher counts in the
nucleus and cuticular plate than the cytoplasm
(Fig. 8). Labeling of the
stereocilia was more conspicuous than with calbindin-D28k, and, similar to
calbindin-D28k, was marked around the edges of the stereocilia near the
membrane (Fig. 8A).
Cytoplasmic labeling was totally abolished by preadsorption of the antibody
with parvalbumin-3 but was unaffected by preadsorption with
parvalbumin-
(Fig. 9).
Thus, the gold particles per field of view without and with preadsorption with
parvalbumin-
were 30.4 ± 4.4 (n = 20) and 29.1 ±
4.9 (n = 20), respectively, in high-frequency cells and 30.7 ±
7.2 (n = 20) and 25.2 ± 4.2 (n = 20) in low-frequency
cells. Because of the high concentrations of calbindin-D28k in turtle hair
cells (see below), it was important to check that the parvalbumin-3 antibody
was not showing any cross reactivity to this protein. Thus, the gold particles
per field of view without and with preadsorption with calbindin-D28k were 23.5
± 5.5 (n = 15) and 25.7 ± 7.9 (n = 15),
respectively. These are not significantly different, indicating that the
parvalbumin-3 antibody is not recognizing calbindin-D28k.

View larger version (135K):
[in this window]
[in a new window]
|
Figure 8. Post-embedding immunogold labeling for parvalbumin-3 in turtle auditory
papilla. A, Section through the apex of a hair cell (hc) and adjacent
supporting cells (sc). Note the labeling of the stereocilia (st),
cuticularplate (cp), and hair-cell cytoplasm but relative lack of labeling in
the mitochondria (examples at arrows) and adjacent supporting cells (sc).
B, Section through the basal region of a hair cell (hc) and adjacent
supporting cell (sc). Note labeling of the nucleus (nu) and hair-cell
cytoplasm but lack of labeling in the adjacent supporting cell and nerve
ending (nt). Scale bar, 0.5 µm.
|
|

View larger version (143K):
[in this window]
[in a new window]
|
Figure 9. Preadsorption controls for parvalbumin-3 labeling of turtle auditory
papilla. A, B, Hair-cell apices labeled simultaneously with the
antibody to parvalbumin-3, either without (A) or with (B)
preadsorption with parvalbumin-3. Note the virtual abolition of labeling after
preadsorption with the protein. C, D, Hair-cell bases labeled
simultaneously with the antibody for parvalbumin-3, either with or without
preadsorption with rat parvalbumin- . Note that there is no effect of
this preadsorption on the labeling. Scale bars, 0.5 µm.
|
|
For each of the proteins, the relative abundance of label was quantified
(see Materials and Methods) by counting gold particles in three locations: the
nucleus and apical cytoplasm of the hair cells and the supporting cells.
Figure 10 gives plots of the
gold particle counts as a function of hair-cell position within the cochlea.
The collected results demonstrate the differential subcellular distributions
of the three proteins and, at least for calbindin-D28k, provide evidence of a
gradient in concentration along the cochlea, increasing toward the
high-frequency end. No gradient was seen with either calretinin or
parvalbumin-3.
Concentrations of calcium-binding proteins
Although all three calcium-binding proteins are found in turtle hair cells,
the ability of any one to act as a calcium buffer will depend on its
cytoplasmic concentration. To calculate a protein concentration from the gold
particle counts, it was necessary to devise a method for calibrating the
particle density. This was achieved by immunogold labeling a section of gel
containing a known amount of protein for comparison with a cochlear section
that was processed at the same time and in the same fluid drop. The method
makes no assumption about the protein distribution and enables its
concentration to be determined in different parts of the cell. The gel was
formed from a solution of the protein in 10% BSA and PBS, fixed in 4%
paraformaldehyde, and solidified by addition of 0.l% glutaraldehyde. The
glutaraldehyde was needed to coagulate the solution but was not included in
the original fixative because it reduces antibody labeling. For each protein,
the counts in the standards were matched to hair-cell measurements made at an
LF and an HF position in the cochlea, approximately one-third and two-thirds
of the distance along the basilar membrane. The calculated concentrations of
calbindin-D28k in the apical cytoplasm (corrected for the 2.5-fold reduction
in labeling of the standards caused by use of the glutaraldehyde fixative; see
Materials and Methods) were 378 ± 95 µM (n = 10;
HF) and 187 ± 64 µM (n = 10; LF). The equivalent
cytoplasmic values for calretinin, measured in the adjacent cochlear section,
were 9 ± 3 µM (n = 6; HF) and 11 ± 2
µM (n = 10; LF). The gold particle counts in the
nucleus were approximately fourfold larger than in the cytoplasm
(Fig. 10), which implies a
nuclear calretinin of
40 µM.
The predicted cytoplasmic concentrations for calbindin-D28k were much
higher than the 5 µM standard in the gel, requiring a large and
potentially inaccurate extrapolation. A second estimate was therefore obtained
using a more concentrated 225 µM calbindin-D28k standard. This
standard was processed and compared with tissue that had already been fixed in
4% paraformaldehyde plus 0.1% glutaraldehyde, thus avoiding the need to apply
the glutaraldehyde correction. This second calibration gave a mean cytoplasmic
calbindin-D28k of 129 ± 95 µM (n = 20) for the
low-frequency region and 627 ± 151 µM (n = 20)
for the high-frequency region. These values are in general accord with the
initial measurements, confirming a calbindin-D28k concentration of several
hundred micromolar, but the range is larger for the same cochlear
positions.
The calibrations indicate that the cytoplasmic concentration of
calbindin-D28k is 1360 times that of calretinin. This ratio is
surprising given the prominent immunofluorescent labeling observed with the
calretinin antibody, but it may reflect the greater efficiency of the
calretinin antibody. Thus, from the immunoblots
(Fig. 1), the polyclonal
anti-calretinin (Chemicon) was approximately four times more effective than
the polyclonal anticalbindin-D28k (SWant) for staining the same amount of
protein. The number of gold particles per field of view, measured at the same
magnification for the two antibodies, can be used to deduce the relative
amounts of the two proteins if the numbers are corrected for the difference in
the efficiency of labeling between the two antibodies. These give the ratio of
cytoplasmic calbindin-D28k to calretinin as 18 (LF) and 51 (HF), which is
similar to the values from the calibrations.
Immunogold counts of parvalbumin-3 in cochlear sections were also
calibrated against known concentrations of the protein fixed in a gel
processed at the same time and in the same fluid drop. After correcting for
the attenuation in labeling caused by glutaraldehyde (see Materials and
Methods), the concentrations of parvalbumin-3 were 223 ± 51
µM (n = 30) in the cytoplasm of hair cells at the LF
end and 256 ± 72 µM (n = 24) at the HF end. The
fractional distances along the basilar membrane for these measurements were
0.2 (LF) and 0.75 (HF). These values indicate the presence of a substantial
amount of parvalbumin-3, comparable with that of calbindin-D28k. However
unlike calbindin-D28k, there was no difference in concentration between hair
cells at the high- and low-frequency ends of the cochlea. Similar to the two
other calcium-binding proteins, the concentration of parvalbumin-3 in the
nucleus was at least twofold larger than in the cytoplasm
(Fig. 10).
Mammalian cochlea
Parvalbumin-3 displays a strong sequence similarity to oncomodulin, a
calcium-binding protein that has been reported to be present in mammalian
outer hair cells (Sakaguchi et al.,
1998
). To confirm this observation and to examine the specificity
of the frog anti-parvalbumin-3 antibody, we therefore studied the distribution
of parvalbumin-3 labeling in the mammalian cochlea. Immunolabeling was found
in both inner and outer hair cells showing a subcellular distribution
identical to that observed in the turtle, with occurrence in both cell body
and stereocilia (Fig. 11). The
amount of label in the nucleus was two to three times that in the cytoplasm
and stereocilia. Preadsorbing with the frog parvalbumin-3 protein to which the
antibody was made abolished labeling on both inner and outer hair cells.
Preadsorption with parvalbumin-
significantly reduced the signal in
inner hair cells (Fig. 12) but
not in outer hair cells. The gold particles per field of view of inner
hair-cell cytoplasm without and with preadsorption with parvalbumin-
were (mean ± 1 SEM) 6.6 ± 0.5 (n = 20) and 4.4 ±
0.4 (n = 20), respectively, in the apical turn of the cochlea and 5.9
± 0.5 (n = 20) and 4.4 ± 0.5 (n = 20) in the
basal turn. Between one-quarter and one-third of the labeling in inner hair
cells was thus removed by preadsorbing with parvalbumin-
. The
equivalent values in outer hair cells without and with preadsorption with
parvalbumin-
were 16.3 ± 1.9 (n = 20) and 16 ±
1.8 (n = 20), respectively, in the apical turn and 15.2 ± 1.3
(n = 20) and 16.4 ± 1.8 (n = 20) in the basal turn.
Thus, for outer hair cells, there was no significant difference before and
after preadsorbing with parvalbumin-
.

View larger version (140K):
[in this window]
[in a new window]
|
Figure 11. Immunogold labeling of guinea pig cochlear hair cells with the antibody for
parvalbumin-3. A, C, Outer hair-cell apex and base, respectively;
B, D, inner hair-cell apex and base, respectively. Note that the
outer hair-cell stereocilia (st), cuticular plate (cp), and cytoplasm (cy) are
all more heavily labeled than the same features in the inner hair cell and
that the mitochondria (arrows) in both types of cell are not labeled. Scale
bars, 0.5 µm.
|
|

View larger version (98K):
[in this window]
[in a new window]
|
Figure 12. Immunogold labeling of guinea pig inner hair-cell apices with the antibody
for parvalbumin-3 either without (A) or with (B)
preadsorption with parvalbumin- . The labeling was reduced but not
abolished after preadsorption with the protein. Scale bar, 0.5 µm.
|
|
An explanation for these results is that the parvalbumin-3 antibody shows
some cross reactivity to parvalbumin-
. On this hypothesis,
parvalbumin-
is present in inner but not outer hair cells, which agrees
with previous observations by Pack and Slepecky
(1995
), who used a monoclonal
antibody to parvalbumin-
. However, both types of hair cell may also
contain a protein related to parvalbumin-3, most likely oncomodulin. From the
gold particle counts, the latter protein is nearly fourfold more concentrated
in outer hair cells than in inner hair cells. Its presence in inner hair
cells, albeit at a lower concentration, contrasts with the conclusion of
Sakaguchi et al. (1998
) that
oncomodulin occurred only in outer hair cells. Our results show no convincing
evidence for a tonotopic gradient in parvalbumin-3.
 |
Discussion
|
|---|
Concentrations of calcium-binding proteins
The calcium-binding proteins calbindin-D28k, calretinin, and parvalbumin
have all been proposed to act as intracellular calcium buffers, and all are
present in turtle auditory hair cells. Labeling for calbindin-D28k and
parvalbumin-3 was specific to hair cells, but labeling for calretinin was seen
in hair cells, supporting cells, and nerve terminals. Molecular biological
results indicated that the form of parvalbumin present in the turtle cochlea
was identical to that in turtle muscle, which has been assigned to the
parvalbumin-
lineage (Maeda et al.,
1984
). The relationship between parvalbumin-3, against which the
antibodies were raised, and parvalbumin-
is described in Materials and
Methods. Antibody labeling was quantified with post-embedding techniques that
circumvent problems attributable to variability in cell permeabilization,
which can hinder the interpretation of immunofluorescence methods. By
comparing labeling in the cochlea with that of a standard containing a known
amount of the calcium-binding protein, we estimated the concentrations of each
of the proteins in the hair-cell cytoplasm. A similar calibration procedure
was first used to determine the glutamate concentration in nerve terminals
(Storm-Mathisen and Ottersen,
1990
) but has not been applied previously to proteins. The method
assumes that the solute is uniformly distributed throughout the gel and, more
importantly, that the antibody recognizes the protein in the standard equally
well to that in the tissue.
The calibrations were performed against recombinant frog parvalbumin-3, rat
calbindin-D28k, and human calretinin because we did not have the equivalent
turtle proteins. However, we cloned major portions of each protein from turtle
and showed that turtle calbindin-D28k was 82% identical at the amino acid
level to the rat version, and turtle calretinin was 91% identical to human
over the N-terminus region to which the antibodies were made. Turtle
parvalbumin-
was 62% identical to frog parvalbumin-3. The lack of
identity may cause the cellular protein concentrations to be underestimated
but is unlikely materially to alter the conclusion that the cytoplasmic
concentrations of calbindin-D28k at 0.130.63 mM and
parvalbumin-
at 0.220.26 mM are >10 times the
concentration of calretinin. Assuming that calbindin-D28k has four Ca
2+-binding sites and parvalbumin-
has two (see below), our
results indicate that the total concentration of cytoplasmic Ca
2+-binding sites of these two proteins will be at least 1.0
mM in low-frequency hair cells and 3.0 mM in
high-frequency cells.
Quantification of immunoblots was also used to derive concentrations of the
calcium-binding proteins as 0.17 mM for calbindin-D28k and 0.20
mM for parvalbumin-3, assuming that these proteins are restricted
to the hair cells. The values are similar to those inferred from the
immunohistochemistry, but they represent an average concentration per cell and
provide no insight about gradients within the cell or along the cochlea. This
problem of immunoblot quantification is more serious for calretinin, which
occurs in supporting cells and auditory nerve terminal as well as hair cells
(Fig. 2). If calretinin were
confined to the sensory epithelium, its mean cellular concentration would be
76 µM (larger that the 40 µM nuclear or 10 µm
cytoplasmic concentration inferred from the quantitative immunogold), but this
is likely to be an overestimate because calretinin also occurs in the
surrounding cells of the cochlear duct.
Role of calcium-binding proteins
Calbindin-D28k and parvalbumin-
differ in a number of respects that
may be important for their role in calcium buffering. Parvalbumin-
is
less than one-half the molecular weight of calbindin-D28k and has only two
calcium-binding sites compared with four in calbindin-D28k. Calcium-binding
properties have been best characterized for calbindin-D28k, which has four
low-affinity sites (KD of 0.20.5 µM),
with fast binding kinetics (kON = 18 x
107 M-1 · sec-1) and high
selectivity for Ca 2+ over Mg2+
(Nägerl et al., 2000
). Of
the two sites in parvalbumin-
, one is a low-affinity Ca
2+-selective site (KD of
0.080.8
µM), as in calbindin-D28k. However, the other site has a
significant affinity for Mg2+, which will compete with Ca
2+, thereby slowing its binding kinetics and lowering its Ca
2+ affinity (Pauls et al.,
1996
). Therefore, in the presence of physiological millimolar
concentrations of Mg2+, both sites on parvalbumin-
will have
similar low affinity for Ca 2+, but one site will bind Ca
2+ rapidly, whereas the other will bind it slowly because it must
first release Mg2+ (Pauls et
al., 1996
). Thus, the combination of calbindin-D28k and
parvalbumin-
in turtle hair cells will contribute both fast and slow
components to calcium buffering.
We measured the total concentration of cytoplasmic Ca 2+-binding
sites contributed by calbindin-D28k and parvalbumin-
to be at least
1.03.0 mM. In comparison, physiological measurements
(Ricci et al., 1998
) indicate
that the mobile buffer in turtle hair cells is equivalent to 0.10.4
mM BAPTA, which binds one Ca 2+ per molecule. Those
experiments measured buffer effects on mechanotransducer channel adaptation,
which depend on calcium gradients near the channels. Such gradients vary with
the product of kON, the calcium-binding rate, and the
buffer concentration (Naraghi and Neher,
1997
). kON is not known for
parvalbumin-
, but, for calbindin-D28k, the most recent measurements give
18 x 107 M-1 ·
sec-1 (Nägerl et al.,
2000
). The two extremes are for each of two pairs of binding
sites, and their average gives a kON for calbindin-D28k of
4.5 x 107 M-1 ·
sec-1, approximately 1/10 of that of BAPTA (4 x
108 M-1 · sec-1). Assuming
similar kON values for calbindin-D28k and
parvalbumin-
, the Ca 2+ buffering capacity of 0.10.4
mM BAPTA is therefore equivalent to 14 mM Ca
2+-binding sites on the two proteins, concentrations not too
different from the values inferred from immunohistochemistry. The results
suggest that calbindin-D28k and parvalbumin-
may together account for
much of the cytoplasmic calcium buffering found in electrophysiological
experiments. However, other calcium-binding proteins, such as calmodulin
(Slepecky and Ulfendahl, 1993
;
Walker et al., 1993
;
Furness et al., 2002
) and
peptide 19 (Imamura and Adams,
1996
), may also contribute to hair-cell calcium buffering.
That calbindin and parvalbumin are effective calcium buffers in
vivo is shown by their ability to attenuate and slow calcium transients
when expressed in dorsal root ganglion cells
(Chard et al., 1993
). Moreover,
mice with a null mutation in the calbindin-D28k gene possess ataxia associated
with exaggerated calcium responses in cerebellar Purkinje cells
(Airaksinen et al., 1997
).
Purkinje cells, like hair cells, contain substantial amounts of both
calbindin-D28k (100200 µM)
(Baimbridge et al., 1982
) and
parvalbumin (45 µM)
(Plogmann and Celio, 1993
).
Parvalbumin does not protect the cells from lack of calbindin-D28k, nor is it
upregulated in the calbindin-D28k null mutant
(Airaksinen et al., 1997
).
However, in mice with knock-outs of both calbindin-D28k and
parvalbumin-
, the effects on Purkinje-cell morphology are more severe
than in single knock-outs of either component alone
(Vecelio et al., 2000
). This
suggests that both calcium-binding proteins are involved in regulating
Purkinje-cell calcium. A similar situation may also exist in turtle hair
cells.
What role does calretinin then play? Although it has been suggested to be
the principal endogenous calcium buffer in frog saccular hair cells
(Edmonds et al., 2000
), its
low cytoplasmic concentration and localization to the nucleus argue against
this notion in the turtle. In pituitary neurons, calcium is compart-mentalized
into distinct cytosolic and nuclear pools
(Hardingham et al., 1997
), and
the nuclear pool may be important for regulating gene expression
(Mellström and Naranjo,
2001
). Although calretinin occurs in inner hair cells in adult
mice, during development, its expression in the outer hair cells is only
transient, appearing first at the base of the cochlea and spreading toward the
apex before disappearing at the onset of hearing
(Dechesne et al., 1994
). Thus,
calretinin may have some distinct role associated with calcium buffering or
signaling in the nucleus.
Tonotopic gradients in calcium-binding proteins
Our light-microscopic (Fig.
3) and electron-microscopic
(Fig. 10) results both
indicate a tonotopic gradient in the hair-cell concentration of
calbindin-D28k. Immunocytochemistry has also revealed a gradient of
calbindin-D28k in the cochleae of both mammals
(Pack and Slepecky, 1995
;
Imamura and Adams, 1996
) and
birds (Hiel et al., 2001
). In
the turtle, the increase in calbindin-D28k concentration with CF correlates
with the increased calcium influx through larger numbers of mechanoelectrical
transducer channels (Ricci and Fettiplace,
1997
) and voltage-dependent calcium channels
(Ricci et al., 2000
). The
increase in calbindin-D28k concentration in the chick cochlea may also reflect
an increase in the number of voltage-dependent calcium channels with CF
(Martinez-Dunst et al., 1997
).
The calbindin-D28k gradients in turtle and chick auditory organs are opposite
to that in the mammal, in which the calcium-binding protein is most
concentrated at the low-frequency end of the cochlea
(Pack and Slepecky, 1995
;
Imamura and Adams, 1996
). If
calbindin-D28k is a major calcium-binding protein in mammalian hair cells, it
might be expected by analogy with the turtle that low-frequency hair cells
have a higher calcium load than high-frequency hair cells. This implies a
difference in calcium signaling between auditory hair cells of mammals and
nonmammalian vertebrates. More information about the role of calbindin and
other calcium-binding proteins in the mammalian cochlea might be obtained by
additional quantitative immunogold experiments.
 |
Footnotes
|
|---|
Received Nov. 14, 2002;
revised Mar. 10, 2003;
accepted Mar. 24, 2003.
This work was supported by grants from the Wellcome Trust (C.M.H.) and the
Steenbock fund of the University of Wisconsin and National Institutes on
Deafness and Other Communicative Disorders Grant RO1 DC 01362 (R.F.). We thank
Mary Reynolds for much excellent technical assistance. We are also grateful to
Stefan Heller and Jim Hudspeth for the gifts of bullfrog parvalbumin-3 and its
antibody.
Correspondence should be addressed to Robert Fettiplace, 185 Medical
Sciences Building, 1300 University Avenue, Madison, WI 53706. E-mail:
fettiplace{at}physiology.wisc.edu