Abstract
Both the sympathetic nervous system and the renin-angiotensin system are critically involved in hypertension development. Although angiotensin II (Ang II) stimulates hypothalamic paraventricular nucleus (PVN) neurons to increase sympathetic vasomotor tone, the molecular mechanism mediating this action remains unclear. The glutamate NMDAR in the PVN controls sympathetic outflow in hypertension. In this study, we determined the interaction between α2δ-1 (encoded by Cacna2d1), commonly known as a Ca2+ channel subunit, and NMDARs in the hypothalamus and its role in Ang II-induced synaptic NMDAR activity in PVN presympathetic neurons. Coimmunoprecipitation assays showed that α2δ-1 interacted with the NMDAR in the hypothalamus of male rats and humans (both sexes). Ang II increased the prevalence of synaptic α2δ-1–NMDAR complexes in the hypothalamus. Also, Ang II increased presynaptic and postsynaptic NMDAR activity via AT1 receptors, and such effects were abolished either by treatment with pregabalin, an inhibitory α2δ-1 ligand, or by interrupting the α2δ-1–NMDAR interaction with an α2δ-1 C terminus-interfering peptide. In Cacna2d1 knock-out mice (both sexes), Ang II failed to affect the presynaptic and postsynaptic NMDAR activity of PVN neurons. In addition, the α2δ-1 C terminus-interfering peptide blocked the sympathoexcitatory response to microinjection of Ang II into the PVN. Our findings indicate that Ang II augments sympathetic vasomotor tone and excitatory glutamatergic input to PVN presympathetic neurons by stimulating α2δ-1-bound NMDARs at synapses. This information extends our understanding of the molecular basis for the interaction between the sympathetic nervous and renin-angiotensin systems and suggests new strategies for treating neurogenic hypertension.
SIGNIFICANCE STATEMENT Although both the sympathetic nervous system and renin-angiotensin system are closely involved in hypertension development, the molecular mechanisms mediating this involvement remain unclear. We showed that α2δ-1, previously known as a calcium channel subunit, interacts with NMDARs in the hypothalamus of rodents and humans. Angiotensin II (Ang II) increases the synaptic expression level of α2δ-1–NMDAR complexes. Furthermore, inhibiting α2δ-1, interrupting the α2δ-1–NMDAR interaction, or deleting α2δ-1 abolishes the potentiating effects of Ang II on presynaptic and postsynaptic NMDAR activity in the hypothalamus. In addition, the sympathoexcitatory response to Ang II depends on α2δ-1-bound NMDARs. Thus, α2δ-1–NMDAR complexes in the hypothalamus serve as an important molecular substrate for the interaction between the sympathetic nervous system and the renin-angiotensin system. This evidence suggests that α2δ-1 may be a useful target for the treatment neurogenic hypertension.
- autonomic nervous system
- gabapentin
- gabapentinoids
- presynaptic NMDA receptor synapse
- synaptic plasticity
Introduction
Both the sympathetic nervous system and renin-angiotensin system have a central role in hypertension development. Increased sympathetic nerve activity not only results in direct vasoconstriction but also increases renin secretion from the kidney (Richardson et al., 1974). Increased renin release results in the generation of angiotensin I, which is then converted to angiotensin II (Ang II), the major effector peptide of the renin-angiotensin system, leading to Ang II-induced vasoconstriction and antinatriuresis (Edwards et al., 1986; DiBona, 2000). In hypertensive conditions, circulating Ang II can access brain regions to stimulate presympathetic neurons in the brain (Zhang et al., 2010; Biancardi et al., 2014), resulting in heightened sympathetic vasomotor tone. However, the cellular and molecular mechanisms involved in the interaction between the sympathetic nervous system and the renin-angiotensin system remain uncertain.
Forebrain structures, especially the hypothalamic paraventricular nucleus (PVN), are critically involved in the control of the sympathetic nervous system and play an important role in the pathogenesis of hypertension (Eilam et al., 1991; Allen, 2002; Li and Pan, 2007). The PVN represents the rostral extension of a serial connection of sympathetic-related neurons extending caudally to the spinal cord (Strack et al., 1989; Coote et al., 1998). The rostral ventrolateral medulla (RVLM) and spinal intermediolateral cell column (IML) neurons receive abundant, highly organized projections from the PVN, and the PVN neurons that project to the RVLM and spinal IML are considered presympathetic neurons. Ang II can stimulate PVN presympathetic neurons to augment sympathetic outflow (Li et al., 2003, 2006; Wang et al., 2013; Khanmoradi and Nasimi, 2016). Increased glutamate NMDAR activity also leads to augmented glutamatergic input to PVN presympathetic neurons and sympathetic outflow in hypertension (Li and Pan, 2007; Li et al., 2008; Qiao et al., 2017). Deletion of the NMDAR subunit GluN1 in the PVN attenuates Ang II-induced increases in blood pressure in mice (Glass et al., 2015). Nevertheless, it is still unclear whether and how Ang II affects presynaptic or postsynaptic NMDARs in the PVN.
Generally known as a voltage-activated Ca2+ channel (VACC) subunit, α2δ-1 (encoded by Cacna2d1), is the binding site of gabapentinoids, including gabapentin and pregabalin (Gee et al., 1996; Marais et al., 2001; Fuller-Bicer et al., 2009), which are widely used to treat neuropathic pain and epilepsy. For many years, α2δ-1 has been assumed to be involved exclusively in the regulation of VACCs. However, gabapentinoids have little effect on VACC activity (Rock et al., 1993; Schumacher et al., 1998; Chen et al., 2018) or VACC-mediated neurotransmitter release at presynaptic terminals (Brown and Randall, 2005; Hoppa et al., 2012). We recently discovered that α2δ-1 is an interacting protein of NMDARs in the spinal cord (Chen et al., 2018). Although α2δ-1 is highly expressed in the PVN (Cole et al., 2005; Taylor and Garrido, 2008), researchers still do not know whether α2δ-1 plays a role in Ang II signaling in the PVN. In this study, we wanted to find out whether α2δ-1 can interact with NMDARs and mediate the action of Ang II in the PVN. We demonstrated that Ang II increases presynaptic and postsynaptic NMDAR activity by potentiating the synaptic trafficking of α2δ-1-bound NMDARs. Our study shows for the first time that α2δ-1-bound NMDARs serve as a key molecular mechanism for Ang II's action in the hypothalamus and for the interaction between the sympathetic nervous system and the renin-angiotensin system.
Materials and Methods
Animals.
We used 10–12-week-old male Sprague Dawley rats (Harlan Sprague Dawley) and both male and female mice (C57BL/6 genetic background) in our experiments. Two breeding pairs of Cacna2d1+/− mice were purchased from Medical Research Council, and Cacna2d1−/− (knock-out) mice and Cacna2d1+/+ (wild-type) littermates were obtained by breeding the heterozygous mice. Because we found no sex differences in the effect of Ang II on synaptic NMDAR activity, electrophysiological data from male and female mice were pooled. All surgical preparation and experimental protocols were approved by the Animal Care and Use Committee of The University of Texas MD Anderson Cancer Center and conformed to the National Institutes of Health guidelines for the ethical use of animals. All efforts were made to minimize both the suffering and the number of animals used.
Retrograde labeling of spinally projecting PVN neurons.
Rats or mice were anesthetized with 2–3% isoflurane, and their spinal cords at the T1–T4 level were exposed through dorsal laminectomy. A fluorescent microsphere suspension (FluoSpheres, 0.04 μm; Invitrogen) was pressure ejected (Nanoject II Microinjectors, Drummond Scientific Company) bilaterally into the IML region of the spinal cord in six separate 50 nl injections using a glass micropipette (tip diameter, 20–30 μm). The tracer injection was monitored through a surgical microscope (Li et al., 2002, 2003). The wound was closed with sutures after injection. Animals were returned to their cages for 4–7 d, which was sufficient time to permit the tracer to be retrogradely transported to the PVN. The animals were inspected daily for motor activity, signs of infection, and food and water intake.
Brain slice preparation.
Four to 7 d after fluorescent tracer injection, the animals were anesthetized with isoflurane and immediately decapitated. The brain was quickly removed and placed in ice-cold artificial CSF (aCSF) saturated with 95% O2 and 5% CO2. A tissue block containing the hypothalamus was cut from the brain and glued onto the stage of a vibratome (Leica VT1000 S, Leica Biosystems) as described previously (Li et al., 2003; Ye et al., 2011). Coronal slices (thickness, 300 μm) containing the PVN were cut from the tissue block in the ice-cold aCSF. The slices were preincubated in aCSF, which was continuously gassed with 95% O2 and 5% CO2 at 34°C for ≥1 h before being used for recording. The perfusion solution contained the following (in mmol/L): 126 NaCl, 3 KCl, 1.5 MgCl2, 2.4 CaCl2, 1.2 NaH2PO4, 11 glucose, and 26 NaHCO3 (300–310 mOsmol/L). The brain slices were placed in a glass-bottom chamber and continuously perfused with aCSF at 3.0 ml/min at 34°C maintained by an in-line solution heater and temperature controller.
Electrophysiological recordings.
The fluorescence-labeled neurons located in the medial one-third of the PVN area between the third ventricle and the fornix were selected for recording (Li et al., 2002, 2003). The labeled PVN neurons were briefly identified with the aid of epifluorescence illumination, and whole-cell recordings from labeled PVN neurons were performed under differential interference contrast optics on an upright microscope (BX50 WI, Olympus Optical). Recordings of postsynaptic currents began 5 min after the whole-cell access was established and the current reached a steady state.
The miniature EPSCs (mEPSCs) were recorded in the presence of 1 μmol/L tetrodotoxin (TTX) and 20 μmol/L bicuculline at a holding potential of −60 mV (Li et al., 2003; Ye et al., 2011). The recording glass pipette (5–10 MΩ) was filled with internal solution containing the following (in mmol/L): 135.0 potassium gluconate, 5.0 tetraethylammonium, 2.0 MgCl2, 0.5 CaCl2, 5.0 HEPES, 5.0 EGTA, 5.0 Mg-ATP, 0.5 Na-GTP, and 10 lidocaine N-ethyl bromide (adjusted to pH 7.2–7.4 with 1 m KOH; 290–300 mOsmol/L). Signals were processed with an Axopatch 700B amplifier (Molecular Devices). A liquid junction potential of 15 mV (for the potassium gluconate pipette solution) was corrected during off-line analysis. Signals were filtered at 1–2 kHz, digitized at 10 kHz using Digidata 1440A (Molecular Devices), and saved to the computer.
Postsynaptic NMDAR currents were elicited by puff application of 100 μmol/L NMDA to the recorded neuron using a positive pressure system (4 psi, 50 ms; Toohey). The tip of the puff pipette was placed 150 μm from the recorded neuron. The recordings were performed in the Mg2+-free extracellular solution containing 10 μmol/L glycine and 1 μmol/L TTX at a holding potential of −60 mV (Li et al., 2008; Ye et al., 2011). The pipette internal solution contained the following (in mmol/L): 110.0 Cs2SO4, 2.0 MgCl2, 0.1 CaCl2, 1.1 EGTA, 10.0 HEPES, 2.0 Mg-ATP, 0.3 Na2GTP, and 10 lidocaine N-ethyl bromide (pH was adjusted to 7.25 with 1.0 m CsOH; 280–300 mOsmol/L). The puff NMDAR currents were fairly stable during the recordings. The NMDAR current data presented in the manuscript were the average of three consecutive currents elicited by repeated puff NMDA. We discarded the neuron if the current was not stable.
Ang II, losartan, and NMDA were obtained from Sigma-Aldrich. The α2δ-1Tat peptide and scrambled control peptide were synthesized by Bio Basic and validated by liquid chromatography and mass spectrometry. Pregabalin was obtained from Tocris Bioscience. TTX and dl-2-amino-5-phosphonopentanoic acid (AP5) were purchased from Hello Bio. All drugs were prepared immediately before the experiments and applied to the slice chamber. The brain slices were first pretreated with Ang II, losartan, α2δ-1Tat peptide, or control peptide in the slice incubation chamber before recording. For electrophysiological recording, we immediately removed the treatment agents and transferred the brain slice to a separate recording chamber.
Coimmunoprecipitation using hypothalamic tissues.
Rat hypothalamic slices containing the PVN were sectioned 1.08–2.12 mm caudal to the bregma. For each sample used for coimmunoprecipitation assay, we pooled hypothalamic tissues from three rats. The frozen hypothalamic tissues were also obtained from four human donors (two males and two females; age range, 18–36 years; University of Maryland Brain and Tissue Bank). The tissues were dissected and homogenized in ice-cold hypotonic buffer (20 mmol/L Tris, pH 7.4, 1 mmol/L CaCl2, 1 mmol/L MgCl2, and the protease inhibitor mixture) for membrane preparation. The nuclei and unbroken cells were removed by centrifugation at 2,000 × g for 10 min. The supernatant was centrifuged for 30 min at 21,000 × g. The pellets were resuspended and solubilized in immunoprecipitation buffer (50 mmol/L Tris, pH 7.4, 250 mmol/L NaCl, 0.5% NP-40, and a protease inhibitor mixture), and the soluble fraction was incubated at 4°C overnight with Protein G beads (#16-266, EMD Millipore) prebound to mouse anti-GluN1 antibody (#75-272, 1:1000, NeuroMab, RRID:AB_11000180). Protein G beads prebound to mouse IgG were used as controls. Samples were washed three times with immunoprecipitation buffer and then immunoblotted with rabbit anti-α2δ-1 antibody (1:500; #ACC-015, Alomone Labs, RRID:AB_2039785).
Protein level analysis in hypothalamic synaptosomes.
The hypothalamic tissues containing the PVN (pooled from two rats per sample) were homogenized using 10 volumes of ice-cold HEPES-buffered sucrose (0.32 mol/L sucrose, 1 mmol/L EGTA, and 4 mmol/L HEPES, pH 7.4) containing the protease inhibitor mixture (Sigma-Aldrich). The homogenate was centrifuged at 2,000 × g for 10 min at 4°C to remove the nuclei and large debris. The supernatant was centrifuged at 20,000 × g for 30 min to obtain the crude synaptosomal fraction. The synaptosomal pellet was lysed via hypo-osmotic shock in 9 volumes of ice-cold HEPES buffer with the protease inhibitor mixture for 30 min. The lysate was centrifuged at 25,000 × g for 45 min at 4°C to obtain the synaptosomal membrane fraction (Chen et al., 2018), which was then dissolved in SDS sample buffer at a final concentration of 0.25 μg/μl for immunoblotting.
Western blotting was used to quantify GluN1 and α2δ-1 protein levels in the hypothalamic synaptosome. Fifteen micrograms of total proteins from each sample were loaded and separated by 4–15% Tris-HCl SDS-PAGE (#456-1086, Bio-Rad). The resolved proteins were transferred to a polyvinylidene difluoride membrane (Millipore). The membrane was treated with 5% nonfat dry milk in Tris-buffered saline (TBS) at 25°C for 1 h and then incubated in TBS supplemented with 0.1% Triton X-100, 1% bovine serum albumin, and rabbit anti-GluN1 (1:100; #G8913, Sigma-Aldrich, RRID:AB_259978), rabbit anti-α2δ-1 (1:500; #ACC-015, Alomone, RRID:AB_2039785), and mouse anti-PSD-95 (1:1000; #75-348, NeuroMab, RRID:AB_2315909) antibodies overnight at 4°C. The membrane was washed three times and then incubated with horseradish peroxidase-conjugated anti-rabbit IgG (1:5000; Jackson ImmunoResearch) for 1 h at room temperature. The protein bands were detected with an enhanced chemiluminescence kit (Thermo Fisher Scientific), and protein band intensity was visualized and quantified using an Odyssey Fc Imager (LI-COR Biosciences). The protein levels of GluN1 and α2δ-1 were normalized by the PSD-95 protein band on the same gel.
PVN microinjection and recording of renal sympathetic nerve activity.
Rats were anesthetized with a mixture of α-chloralose (60 mg/kg, i.p.) and urethane (800 mg/kg, i.p.). A retroperitoneal incision was made and a branch of the left renal postganglionic sympathetic nerve was isolated under a surgical microscope. The renal sympathetic nerve was cut distally to ensure that afferent nerve activity was not recorded. The renal sympathetic nerve activity (RSNA), arterial blood pressure (ABP), and heart rate (HR) were recorded using a 1401-PLUS analog-to-digital converter and Spike2 system (Cambridge Electronic Design). A microinjection pipette (tip diameter, 20–30 μm) was advanced into the PVN according to the following stereotactic coordinates: 1.6–2.0 mm caudal to the bregma, 0.5 mm lateral to the midline, and 7.0–7.5 mm ventral to the dura. The microinjection was done using a calibrated microinjection system (Nanoject II, Drummond Scientific) and monitored using a surgical microscope as described previously (Li and Pan, 2006, 2007; Qiao et al., 2017). Ang II (200 μmol/L, 50 nl) was microinjected into the PVN to observe the change in RSNA and ABP in the absence or presence of α2δ-1Tat peptide (100 μmol/L, 50 nl) or control peptide (100 μmol/L, 50 nl). The microinjections were separated by 10–15 min intervals to allow recovery of the response. To determine the location of the injection site and diffusion of the drugs in the PVN, we included 5% rhodamine-labeled fluorescent microspheres (0.04 μm; Invitrogen) in the injection solution (Li and Pan, 2006, 2007; Qiao et al., 2017).
Study design and data analysis.
Data are presented as means ± SEM. No statistical methods were used to predetermine sample sizes for biochemical studies, but our sample sizes were similar to those generally used in the field. Data collection was randomized, and data distribution was determined using the Kolmogorov–Smirnov normality test. Rats were excluded from analysis if the microinjection site was outside the PVN. In electrophysiological recording experiments, we monitored cell capacitance, input resistance, series resistance, and baseline holding current; we excluded cells if the recording indicated a rundown condition. Only one neuron in each brain slice was recorded, and ≥3 animals were used for each recording protocol. The amplitude and frequency of mEPSCs were analyzed off-line with a peak detection program (MiniAnalysis; Synaptosoft). The cumulative probability of the amplitude and interevent interval was compared using the Kolmogorov–Smirnov test, which estimates the probability that two cumulative distributions are similar. The peak amplitude of puff NMDA-induced currents was determined and analyzed using pClamp and Clampfit 10.2 (Molecular Devices). The mean ABP, RSNA, and HR were analyzed using Spike2 software. The mean ABP was derived from the pulsatile ABP and calculated as the diastolic pressure plus one-third of the pulse pressure. RSNA was rectified and integrated off-line after subtracting the background noise, which was recorded after the proximal end of renal nerve was crushed at the end of each experiment. The integrated RSNA value was calculated and derived from raw RSNA with an integrating time of 1.0 s using Spike2 software. Control values were obtained by averaging the signal over a 60 s period immediately before PVN microinjection. Response values after each intervention were averaged over 30 s when the maximal responses occurred. A two-tailed Student's t test was used to compare two groups, and one-way ANOVA, followed by Dunnett's and Tukey's post hoc tests, was used to compare >2 groups. Statistical analyses were performed using Prism 6 software (GraphPad Software). p < 0.05 was considered statistically significant.
Results
α2δ-1 Physically interacts with NMDARs in the hypothalamus of rats and humans
We recently showed that α2δ-1 physically interacts with NMDAR subunits in the spinal cord (Chen et al., 2018). To determine whether α2δ-1 and NMDARs interact in the hypothalamus, we conducted coimmunoprecipitation analyses using membrane extracts of the rat hypothalamus. Using specific antibodies, α2δ-1 was coprecipitated with GluN1, an obligatory subunit of NMDARs (Fig. 1A), whereas the irrelevant IgG did not pull down α2δ-1 in the hypothalamic tissue.
In addition, the anti-GluN1 antibody, but not IgG, coimmunoprecipitated with α2δ-1 in membrane extracts from human hypothalamic tissues (n = 4 subjects; Fig. 1A). These results indicate that α2δ-1 physically interacts with NMDARs in the hypothalamus in both rats and humans.
Ang II increases the prevalence of α2δ-1–NMDAR complexes in the hypothalamus
The synaptic NMDARs are highly dynamic and depend on trafficking from their intracellular pool (Tovar and Westbrook, 2002; Chen et al., 2018). We thus determined whether Ang II increases synaptic targeting of α2δ-1–NMDAR complexes in the PVN. Hypothalamic slices were sectioned 1.08–2.12 mm caudal to bregma and treated with Ang II (2 μmol/L) or vehicle for 60 min. Synaptosomes were then isolated from the tissue slices. Immunoblotting showed that Ang II significantly increased the protein levels of GluN1 (p = 0.043, t(10) = 2.237; n = 12 rats/group) and α2δ-1 (p = 0.004, t(10) = 3.724, n = 12 rats/group) in hypothalamic synaptosomes (Fig. 1B,C).
We next determined whether the α2δ-1–NMDAR interaction is involved in Ang II-induced increases in the protein levels of GluN1 and α2δ-1 at the synaptic sites. Hypothalamic slices were incubated with Ang II for 60 min in the presence of control peptide or α2δ-1Tat peptide. We have shown that the C terminus of α2δ-1 is essential for its interaction with NMDARs and that a 30 aa peptide (VSGLNPSLWSIFGLQFILLWLVSGSRHYLW) mimicking the C-terminal domain of α2δ-1 fused with Tat protein (YGRKKRRQRRR) can uncouple the α2δ-1–NMDAR interaction (Chen et al., 2018). The effect of Ang II on the protein levels of GluN1 (p = 0.014, t(12) = 2.862; n = 14 rats/group) and α2δ-1 (p = 0.0003, t(12) = 4.956; n = 14 rats/group) was significantly attenuated in hypothalamic synaptosomes treated with α2δ-1Tat peptide (1 μmol/L for 30 min), compared with those treated with a Tat-fused scrambled control peptide (FGLGWQPWSLSFYLVWSGLILSVLHLIRSN; Fig. 1D,E). These data suggest that Ang II increases the synaptic targeting/trafficking of α2δ-1-bound NMDARs in the hypothalamus.
Ang II increases presynaptic and postsynaptic NMDAR activity via AT1 receptors in spinally projecting PVN neurons
Systemic administration of Ang II in mice is associated with an increased amplitude of NMDA-elicited currents in PVN neurons (Wang et al., 2013). To determine whether Ang II affects the postsynaptic NMDAR activity in spinally projecting PVN neurons, we recorded the NMDAR current elicited by puff NMDA application directly to labeled PVN neurons. Incubation of brain slices with Ang II (2 μmol/L for 30–60 min) markedly increased the amplitude of puff NMDA currents (n = 11 neurons, p = 0.002, F(2,24) = 8.020; Fig. 2A–C). This effect of Ang II on puff NMDAR currents was abolished by coincubation with an angiotensin AT1 receptor antagonist, losartan (2 μmol/L, 30 min; n = 8 neurons; Fig. 2B,C).
To specifically determine whether Ang II affects the presynaptic NMDAR activity of labeled PVN neurons, we examined the effect of Ang II on mEPSCs, which reflects spontaneous quantal release of glutamate from presynaptic terminals (Ye et al., 2011; Qiao et al., 2017). Incubation of brain slices with Ang II (2 μmol/L for 30–60 min) significantly increased the baseline frequency, but not the amplitude, of the mEPSCs of the retrogradely labeled PVN neurons that project to the spinal cord (n = 8 neurons, p = 0.004, F(8,60) = 3.295; Fig. 2D–H). Bath application of the NMDAR antagonist AP5 (50 μmol/L) rapidly reversed the Ang II-induced increase in mEPSC frequency, indicating that presynaptic NMDARs mediate the Ang II-induced increase in synaptic glutamate. In contrast, AP5 application had no effect on the frequency of the mEPSCs of labeled PVN neurons in vehicle-treated slices (n = 8 neurons in each group; Fig. 2D–H). The effect of Ang II on mEPSCs was blocked by pretreatment with 2 μmol/L losartan (Li et al., 2003; n = 7 neurons; Fig. 2D–H). These data suggest that Ang II increases presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons via AT1 receptors.
α2δ-1 Activity is required for Ang II's effect on presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons
α2δ-1 Is a highly glycosylated protein involved in protein trafficking. Both gabapentin and pregabalin bind predominantly to α2δ-1 (Gee et al., 1996; Wang et al., 1999; Marais et al., 2001; Fuller-Bicer et al., 2009) and act as an inhibitory α2δ-1 ligand. In contrast to the potentiating effect of Ang II on the amplitude of NMDAR currents elicited by puff application of NMDA in labeled PVN neurons treated with vehicle (n = 10 neurons), Ang II had no significant effect on puff NMDA currents in brain slices pretreated with pregabalin (n = 7 neurons; Fig. 3A,B).
Although it stimulated the mEPSC frequency in vehicle-treated slices (n = 9 neurons), Ang II failed to increase the frequency of mEPSCs of labeled PVN neurons in brain slices treated with pregabalin (20 μmol/L for 30–60 min, n = 9 neurons; Fig. 3E,F). Furthermore, bath application of AP5 (50 μmol/L) readily normalized the frequency of mEPSCs increased by Ang II plus vehicle but had no effect on the mEPSC frequency in brain slices treated with Ang II plus pregabalin (Fig. 3C–F). These data suggest that α2δ-1 mediates the Ang II-induced increases in presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons.
Disrupting the α2δ-1–NMDAR interaction abolishes Ang II's effect on presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons
We next used the α2δ-1Tat peptide to determine whether α2δ-1-bound NMDARs are required for the Ang II effect on synaptic NMDAR activity of spinally projecting PVN neurons. In brain slices pretreated with α2δ-1Tat peptide (1 μmol/L, 30 min), Ang II (2 μmol/L) had no effect on the amplitude of puff NMDA currents of labeled PVN neurons (n = 9 neurons). In contrast, Ang II significantly increased the amplitude of puff NMDA currents in the presence of the control peptide (1 μmol/L, 30 min; n = 13 neurons; Fig. 4A,B).
In brain slices incubated with the α2δ-1Tat peptide, Ang II failed to increase the frequency of mEPSCs in all labeled PVN neurons (n = 8 neurons; Fig. 4D,E). However, a Tat-fused scrambled control peptide did not affect the stimulating effect of Ang II on the mEPSC frequency in separate labeled PVN neurons (n = 9 neurons; Fig. 4C,E). Bath application of AP5 (50 μmol/L) normalized the increased frequency of mEPSCs in brain slices treated with Ang II plus the control peptide but had no effect on the mEPSC frequency in brain slices treated with Ang II plus α2δ-1Tat peptide (Fig. 4C–F). These findings indicate that α2δ-1-bound NMDARs are essential for Ang II-induced increases in the presynaptic and postsynaptic NMDAR activity of PVN presympathetic neurons.
α2δ-1 Is required for Ang II's effect on presynaptic and postsynaptic NMDAR activities in PVN presympathetic neurons
Because pharmacological agents may produce off-target effects, we next used Cacna2d1 knock-out (Cacna2d1−/−) mice to validate the critical role of α2δ-1 in the Ang II-induced increase in synaptic NMDAR activity. In wild-type (Cacna2d1+/+) mice, Ang II treatment markedly increased the amplitude of puff NMDA-elicited currents (n = 8 neurons per group; Fig. 5A,B) and the NMDAR-mediated frequency of mEPSCs (n = 8 neurons per group; Fig. 5C–H) in spinally projecting PVN neurons. In contrast, in Cacna2d1−/− mice, Ang II treatment had no effect on the amplitude of puff NMDA-elicited currents (n = 10 neurons per group) or on the frequency of mEPSCs (n = 9 neurons per group) in labeled PVN neurons. These data provide unequivocal evidence showing that α2δ-1 is essential for Ang II-induced increases in the synaptic NMDAR activity of PVN presympathetic neurons.
α2δ-1-Bound NMDARs are critically involved in the sympathoexcitatory responses to Ang II in the PVN
In addition, we wanted to find out whether α2δ-1-bound NMDARs in the PVN play a role in sympathoexcitatory responses to Ang II in vivo. Because pregabalin and gabapentin bind to both α2δ-1 and α2δ-2 (Gee et al., 1996; Gong et al., 2001; Marais et al., 2001; Li et al., 2011), we used the α2δ-1Tat peptide, which selectively targets and disrupts the α2δ-1–NMDAR association (Chen et al., 2018). We examined the sympathoexcitatory responses elicited by microinjection of Ang II in the PVN in the presence of α2δ-1Tat peptide or the control peptide. As reported previously (Khanmoradi and Nasimi, 2016), microinjection of Ang II (200 μmol/L, 50 nl) into the PVN in anesthetized rats significantly increased the RSNA and mean ABP, and such effects were not altered by prior microinjection of the control peptide (n = 10 rats; Fig. 6A–H). In contrast, when α2δ-1Tat peptide (100 μmol/L, 50 nl) was microinjected into the PVN, subsequent microinjection of Ang II into the PVN failed to significantly increase ABP and RSNA (n = 10 rats; Fig. 6A,C–E). These data suggest that α2δ-1-bound NMDARs are required for the sympathoexcitatory responses to Ang II in the PVN.
Discussion
The most salient finding of our study is that a switch from α2δ-1-free to α2δ-1-bound NMDARs is essential for the Ang II-induced increase in synaptic NMDAR activity in the hypothalamus. We recently demonstrated that α2δ-1 interacts with NMDAR subunits in the spinal cord to maintain chronic pain after nerve injury (Chen et al., 2018). In the present study, we found that α2δ-1 physically interacts with NMDARs in the hypothalamus in both rats and humans. We also found that Ang II increases the protein levels of α2δ-1 and NMDARs in the hypothalamic synaptosomes and that blocking the α2δ-1–NMDAR interaction with α2δ-1Tat peptide abolishes this effect of Ang II. These findings suggest that Ang II increases the synaptic trafficking of α2δ-1–bound NMDARs in the hypothalamus. We showed previously that the α2δ-1–NMDAR interaction is increased after nerve injury when there is an excess of α2δ-1 in the spinal cord (Chen et al., 2018). Here we show that this interaction can occur quickly in the hypothalamus following brief Ang II treatment. Thus, α2δ-1 plays an important role in Ang II signaling and in the regulation of NMDARs in the brain.
The PVN, an important brain region controlling sympathetic outflow, sends long descending projections to the brainstem and spinal cord (Swanson and Sawchenko, 1983; Kannan et al., 1989; Coote et al., 1998). In the PVN, presynaptic NMDARs are latent and not functionally active under physiological conditions. However, presynaptic NMDARs of PVN presympathetic neurons become tonically activated in spontaneously hypertensive rats (Ye et al., 2011; Qiao et al., 2017). We showed in this study that Ang II stimulates presynaptic NMDARs, as Ang II caused a large increase in synaptic glutamate release, which was normalized by AP5, a selective NMDAR antagonist. Ang II also markedly increased the amplitude of puff NMDA-elicited currents, which were mediated by postsynaptic NMDARs, in PVN presympathetic neurons. Those effects were blocked by the AT1 receptor antagonist losartan. Thus, Ang II increases presynaptic and postsynaptic NMDAR activity to potentiate glutamatergic input to PVN presympathetic neurons through AT1 receptors. We found that inhibiting α2δ-1 activity with pregabalin abolished the effect of Ang II on presynaptic and postsynaptic NMDAR activity. Furthermore, disrupting the α2δ-1–NMDAR association with α2δ-1Tat peptide obliterated the Ang II effect on the presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons. In addition, the crucial role of α2δ-1 in the effect of Ang II on presynaptic and postsynaptic NMDAR activity in PVN presympathetic neurons was substantiated using Cacna2d1 knock-out mice. Because we recorded mEPSCs and puff NMDAR currents using a negative hold potential and in the presence of TTX, the effect of Ang II on synaptic NMDARs is likely independent of VACCs. Although α2δ-1 may also interact with thrombospondins to promote synaptogenesis (Eroglu et al., 2009), this cannot explain the rapid effects of Ang II and AP5 on mEPSCs. Collectively, our findings provide unambiguous evidence that α2δ-1-bound NMDARs are essential for the Ang II-induced increase in synaptic NMDAR activity in the PVN.
Our in vitro data showing that α2δ-1 is required for the Ang II-induced increase in synaptic NMDAR activity in the PVN prompted us to determine whether α2δ-1-bound NMDARs contribute to the in vivo sympathoexcitatory response to Ang II in the PVN. Circulating Ang II can affect PVN neurons via the circumventricular organs (with permeable blood–brain barrier) and by increasing the blood–brain barrier permeability in hypertension (Zhang et al., 2010; Biancardi et al., 2014). Direct microinjection of Ang II into the PVN produces a pressor response (Li et al., 2006; Khanmoradi and Nasimi, 2016). Also, the importance of NMDARs in the PVN in regulating ABP is supported by the finding that GluN1 deletion in the PVN reduces the increase in ABP by systemic administration of Ang II in mice (Glass et al., 2015). Consistent with our synaptic recording data, we showed that disrupting the α2δ-1–NMDAR interaction with the α2δ-1Tat peptide blocked the pressor and sympathoexcitatory responses to Ang II in the PVN. Notably, clinical studies suggest that gabapentinoids are effective at reducing cardiovascular hemodynamic changes elicited by intubation in surgical patients (Fassoulaki et al., 2006; Bala et al., 2015; Doleman et al., 2016). The ability of pregabalin and α2δ-1Tat peptide to normalize presynaptic and postsynaptic NMDAR activity increased by Ang II suggests that increased synaptic NMDAR activity by Ang II is mediated entirely by α2δ-1-bound NMDARs. In light of this finding, it may be possible to target α2δ-1-bound NMDARs in the PVN to treat neurogenic hypertension without affecting normal NMDAR function.
In conclusion, we present our striking findings that α2δ-1 plays a pivotal role in Ang II-induced potentiation in synaptic NMDAR activity of PVN presympathetic neurons and that α2δ-1-bound NMDARs are required for the sympathetic outflow and blood pressure responses induced by Ang II in the PVN. This new information advances our understanding of the molecular mechanism involved the interaction between the renin-angiotensin and sympathetic nervous systems and suggests that targeting α2δ-1 (with gabapentinoids) and α2δ-1-bound NMDARs (with α2δ-1Tat peptide) may be used as a new strategy for treating neurogenic hypertension.
Footnotes
This work was supported by the National Institutes of Health (Grants HL131161, HL139523, and HL142133) and the N.G. and Helen T. Hawkins Endowment (to H.-L.P.). Human brain tissues were obtained from the Brain and Tissue Bank at the University of Maryland, a repository funded by the National Institutes of Health NeuroBioBank.
The authors declare no competing financial interests.
- Correspondence should be addressed to Dr. Hui-Lin Pan, Department of Anesthesiology and Perioperative Medicine, Unit 110, The University of Texas MD Anderson Cancer Center, 1515 Holcombe Blvd, Houston, TX 77030. huilinpan{at}mdanderson.org