Skip to main content

Main menu

  • HOME
  • CONTENT
    • Early Release
    • Featured
    • Current Issue
    • Issue Archive
    • Collections
    • Podcast
  • ALERTS
  • FOR AUTHORS
    • Information for Authors
    • Fees
    • Journal Clubs
    • eLetters
    • Submit
  • EDITORIAL BOARD
  • ABOUT
    • Overview
    • Advertise
    • For the Media
    • Rights and Permissions
    • Privacy Policy
    • Feedback
  • SUBSCRIBE

User menu

  • Log in
  • My Cart

Search

  • Advanced search
Journal of Neuroscience
  • Log in
  • My Cart
Journal of Neuroscience

Advanced Search

Submit a Manuscript
  • HOME
  • CONTENT
    • Early Release
    • Featured
    • Current Issue
    • Issue Archive
    • Collections
    • Podcast
  • ALERTS
  • FOR AUTHORS
    • Information for Authors
    • Fees
    • Journal Clubs
    • eLetters
    • Submit
  • EDITORIAL BOARD
  • ABOUT
    • Overview
    • Advertise
    • For the Media
    • Rights and Permissions
    • Privacy Policy
    • Feedback
  • SUBSCRIBE
PreviousNext
Articles, Neurobiology of Disease

Enhanced Proteolytic Clearance of Plasma Aβ by Peripherally Administered Neprilysin Does Not Result in Reduced Levels of Brain Aβ in Mice

John R. Walker, Reynand Pacoma, James Watson, Weijia Ou, Juliano Alves, Daniel E. Mason, Eric C. Peters, Hugo D. Urbina, Gus Welzel, Alana Althage, Bo Liu, Tove Tuntland, Laura H. Jacobson, Jennifer L. Harris and Andrew M. Schumacher
Journal of Neuroscience 6 February 2013, 33 (6) 2457-2464; DOI: https://doi.org/10.1523/JNEUROSCI.3407-12.2013
John R. Walker
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Reynand Pacoma
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
James Watson
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Weijia Ou
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Juliano Alves
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Daniel E. Mason
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Eric C. Peters
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Hugo D. Urbina
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Gus Welzel
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Alana Althage
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Bo Liu
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Tove Tuntland
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Laura H. Jacobson
2Nervous System Research, Novartis Institutes for Biomedical Research, CH-4002 Basel, Switzerland
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Jennifer L. Harris
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Andrew M. Schumacher
1Genomics Institute of the Novartis Research Foundation, San Diego, California 92121, and
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
  • Article
  • Figures & Data
  • Info & Metrics
  • eLetters
  • PDF
Loading

Abstract

Accumulation of β-amyloid (Aβ) in the brain is believed to contribute to the pathology of Alzheimer's Disease (AD). Aβ levels are controlled by the production of Aβ from amyloid precursor protein, degradation by proteases, and peripheral clearance. In this study we sought to determine whether enhancing clearance of plasma Aβ with a peripherally administered Aβ-degrading protease would reduce brain Aβ levels through a peripheral sink. Neprilysin (NEP) is a zinc-dependent metalloprotease that is one of the key Aβ-degrading enzymes in the brain. We developed a NEP fusion protein with in vitro degradation of Aβ and a 10 day plasma half-life in mouse. Intravenous administration of NEP to wild-type and APP23 transgenic mice resulted in dose-dependent clearance of plasma Aβ. However, this did not correspond to reduced levels of soluble brain Aβ with treatment up to 5 weeks in WT mice or formic acid-extractable brain Aβ with 3 month treatment in aged APP23. In contrast, intracranial injection of NEP resulted in an acute decrease in soluble brain Aβ. We found no change in amyloid precursor protein gene expression in mice treated with intravenous NEP, suggesting that the lack of effects in the brain following this route of administration was not caused by compensatory upregulation of Aβ production. Taken together, these results suggest a lack of a robust peripheral Aβ efflux sink through which brain amyloid burdens can be therapeutically reduced.

Introduction

Alzheimer's disease (AD) is the leading cause of dementia in the aging population. Pathological hallmarks of the human disease are the accumulation of β-amyloid (Aβ) and formation of amyloid plaques in the brain. Aβ is produced through the cleavage of amyloid precursor protein (APP) by β- and γ-secretases to release soluble Aβ peptide monomers (Hardy and Selkoe, 2002). Human Aβ monomers, primarily consisting of 40 and 42 residue peptides, are able to form insoluble fibrils that can subsequently aggregate into plaques (Masters et al., 1985). The equivalent mouse Aβ peptides, in contrast, contain three amino acid residue substitutions that prevent the formation of plaques, possibly by altering the β-secretase cleavage site (Jankowsky et al., 2007).

Clearance of Aβ from the brain is accomplished partially through degradation by amyloid-degrading enzymes such as the zinc-dependent metalloprotease neprilysin (NEP). NEP-deficient mice have elevated brain Aβ levels and a reduced ability to degrade exogenous Aβ (Iwata et al., 2000, Iwata et al., 2001). Furthermore, inhibition of NEP by thiorphan causes increased accumulation of Aβ and memory impairment (Iwata et al., 2000; Zou et al., 2006). Conversely, increasing neprilysin expression and activity in AD transgenic mouse models reduces plaque formation (Marr et al., 2003; Saito et al., 2005).

Brain Aβ clearance is also accomplished through efflux into the periphery (Shibata et al., 2000; Zlokovic, 2004; Marques et al., 2009), and it has been hypothesized that a dynamic equilibrium exists between these Aβ pools. However, this Aβ efflux appears to be mediated through transporter proteins, the saturation of which may limit the rate and/or degree to which equilibrium can be achieved (Shibata et al., 2000). Despite the sequence differences between human and mouse Aβ peptides, there is no evidence that the clearance mechanisms differ or that the mouse would be a poor model in which to study the intercompartmental equilibrium of monomeric Aβ.

The equilibrium between brain and peripheral Aβ provides the basis for several anti-Aβ vaccination approaches. Some animal data suggest that sequestration of free peripheral Aβ monomers shifts the equilibrium toward increased efflux, leading to reduction of central nervous system Aβ and plaque levels (DeMattos et al., 2001, 2002). This approach has come to be known as the “peripheral sink.” However, other data suggest that anti-Aβ antibodies might be crossing the blood–brain barrier (BBB) at a low rate, acting directly on the brain Aβ and amyloid deposits (Levites et al., 2006; Wang et al., 2011). This possibility is supported by reports that the BBB is compromised in APP-overexpressing mice (Paul et al., 2007) as well as in a fraction of AD patients (Bowman et al., 2007).

Clarification of the mechanism of action of peripherally administered therapeutics that reduce brain amyloid load will have important implications for the pharmacokinetic/pharmacodynamic relationship of anti-amyloid therapies. This in turn may impact how such therapies are developed and tested. In this study we report use of recombinant NEP to degrade plasma Aβ, thus allowing us to determine whether a dynamic, nonsaturated equilibrium exists between the peripheral and brain Aβ pools in mice.

Materials and Methods

Cloning and production of Fc-NEP.

A mouse Fc-fusion construct was created by fusing the extracellular, catalytic domain of mouse NEP (cDNA seq. NM_008604) consisting of residues Y52–W750 to the C-terminal of the mouse IgG1 Fc region consisting of the amino acid sequence MKTFILLLWVLLLWVPGSTGVAAYPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFIYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK. A second construct containing a PreScission Protease (GE Healthcare) cleavage site between the Fc and NEP sequences was also cloned. Expression of the fusion constructs in the vector is driven by a CMV promoter. Plasmids were transiently transfected using the PEI (polyethylenimine) method (Schlaeger and Christensen, 1999) into FreeStyle 293F cells (Invitrogen) grown in suspension in Freestyle 293 Expression medium (Invitrogen). After 72 h, the media containing secreted Fc-NEP was harvested by centrifugation and filtered before purification.

Fc-NEP was purified using Protein A Sepharose Fast Flow (GE Healthcare) equilibrated with 50 mm Tris, pH 8.8, and 125 mm sodium chloride before loading of the media supernatant. Protein was eluted with 100 mm sodium acetate, pH 5.5, containing 125 mm sodium chloride. The Fc-NEP-containing fractions (determined by UV trace) were then further purified by size exclusion on a HiLoad 26/60 Superdex 200 prep grade column (GE Healthcare) equilibrated with Dulbecco's phosphate buffered saline. Fractions containing Fc-NEP, as determined by fluorescent peptide assay activity (described below, NEP activity assays and kinetics) and polyacrylamide gel electrophoresis under nondenaturing conditions, were pooled. To obtain NEP lacking the Fc fusion, the construct containing the PreScission site was taken through the above protocol, followed by cleavage of the Fc domain using immobilized PreScission protease (GE Healthcare).

NEP activity assays and kinetics.

Recombinant Fc-NEP activity was quantified using the chromogenic substrate o-aminobenzoic acid (Abz)-Ala-Glu-Leu-Ala-paranitroaniline (Bachem) in 50 mm Tris, pH 7.0, containing 125 mm NaCl and 0.05% bovine serum albumin (BSA). Substrate hydrolysis was measured over time on a SpectraMax Gemini plate reader (λEX = 340nm and λEM = 420 nm) (Molecular Devices ). Enzyme kinetics assays were carried out at 37°C by varying substrate concentration from 0.06 to 800 μm in the presence of 10 nm Fc-NEP. Vmax was determined from the fastest part of the resulting progression curve for each substrate concentration.

NEP activity in plasma was determined using a coupled assay in which plasma or recombinant Fc-NEP standard was diluted in assay buffer (50 mm Tris pH 7.0, 125 mm NaCl, and 0.05% BSA) and incubated with 200 μm glutaryl-Ala-Ala-Phe-4-methoxy-β-naphthylamide (Sigma) for 5 min at 37°C. NEP activity was inhibited by addition of the metalloproteinase inhibitor, thiorphan, at 333 μm (Sigma). Leucine aminopeptidase (Sigma) was added to a final concentration of 0.58 mg/ml and fluorescence (λEX = 350 nm and λEM = 440 nm) was read on a SpectraMax Gemini plate reader.

NEP degradation of Aβ1–40 in buffer was carried out at 37°C in 50 mm Tris, pH 7, 125 mm NaCl, and 0.05% BSA. Reactions were stopped with thiorphan, and Aβ was measured using an antibody-based HTRF assay (Cisbio Bioassays) as per the manufacturer's instructions.

Mass spectrometry analysis of Aβ proteolysis.

The disappearance of mouse and human Aβ1–40 and Aβ1–42 parent peptides over time in buffer in response to cleavage by mouse Fc-NEP was monitored by multiple reaction monitoring (MRM) on a 4000Qtrap (AB Sciex). The MRM method was developed by first infusing Aβ peptides into a 4000 QTrap using the NanoSpray II source and optimizing instrument parameters (source gases, declustering potential, collision energy, and collision cell exit potential) for the two major charge states and the top five fragment ions for each charge state. Aβ peptides were incubated with 50 nm human Fc-NEP in activity buffer (50 mm Tris, pH 7.0, 125 mm NaCl, 0.005% BSA) and aliquots were removed at 0, 5, 10, 15, 30, 60, and 120 min, acidified to 0.1 m HOAc, and analyzed by nano-liquid chromatography/mass spectrometry (nano-LC/MS) with the above MRM method on the 4000 QTrap with vented column setup (Licklider et al., 2002). Samples were loaded and desalted on a 360 × 200 μm precolumn with 3 cm Poros10R2 (Applied Biosystems) and then placed in-line with a 60 × 75 μm integrated tip packed with 1 cm Poros10R2. Peptides were separated with a 10 min gradient from 0 to 40% solvent B (0.1% HOAc, acetonitrile). Instrument parameters were as follows: quadrupoles Q1 and Q3 set to unit resolution; curtain gas to 20 psig (pounds per square inch gauge); CAD (collisionally activated dissociation) gas to 12 psig; ion spray voltage to 2200 V; interface heater to 140°C. Peak areas were calculated for the each transition and summed for each peptide. The 30 min incubation was also analyzed by nano-LC/MS/MS (tandem mass spectrometry) to identify cleavage products from the Aβ peptides. MRM transitions were developed and optimized for the most abundant peptides, such as the internal sequence peptides YEVHHQKL and FAEDVGSNKGA. The Fc-NEP, Aβ peptide incubations were repeated and cleaved fragments targeted by nano-LC/MS with MRM as before except that the columns were packed with Monitor C18 (Column Engineering).

In vivo treatment of animals with Fc-NEP and sample preparation.

All animal studies conformed to Institutional Animal Care and Use Committee-approved protocols. C57BL/6J mice (males, ∼8 weeks old) or APP23 mice (females, 17 months old at the beginning of the study) were dosed intravenously through the tail vein with 200 μl of Fc-NEP or the PBS vehicle. Depending on the treatment schedule, retro-orbital bleeds (20–50 μl per mouse) were performed during the course of the treatments to monitor plasma Aβ and NEP levels. At the end of each study, 600 μl of blood was collected by retro-orbital bleeding within 1 min while mice were under isoflurane anesthesia using 250 μl Natelson blood collecting tubes (Fisher Scientific). Mice were then euthanized in a bell jar containing isoflurane anesthetic, and after 3 min cerebral spinal fluid was collected. CSF was collected from the cisterna magna by cutting with a scalpel behind the head and peeling back the skin from the base of the skull to the eyes. A scalpel was used to make a single cut across the muscle directly over the base of the skull that revealed a triangle-shaped pocket covered by a thin membrane. CSF was collected by piercing this membrane with a small (50 μl) capillary tube sharpened by pulling it through the flame of a Bunsen burner. One microliter of CSF was diluted 1:5 in PBS containing 3% BSA. Mice were then rinsed with PBS, the skull was carefully opened, the brain removed, and the olfactory bulbs and hindbrain were discarded. The remaining forebrain was divided into halves. One half was immediately frozen on dry ice for biochemical assays, and the other half was fixed in formalin. Blood samples were centrifuged at room temperature for 10 min at 1400 × g for volumes over 50 μl or 2 min for 50 μl capillary tubes. Plasma was removed and frozen until processing.

For intracranial injections, mice were anesthetized with isoflurane and a nosecone was used to deliver sufficient isoflurane to maintain the animal at a surgical state as determined by lack of response to a toe pinch. The unshaved skull was gently wiped with betadine or 70% EtOH. A 100 μl Hamilton syringe was prepared with the correct concentration of Fc-NEP or PBS to deliver the desired dose volume of 10 μl. The hub of a 30 gauge needle was attached to the syringe with the sharp tip blunted to fit tightly into the end of a slightly smaller diameter Teflon tube. The tube was measured to be long enough to allow for easy reach to the mouse with the syringe resting on the table top. The hub from another 30 gauge needle was removed and the blunt end was inserted into the opposite end of the tubing. The injecting needle was firmly clamped with a straight hemostat and positioned in the grip so that it could only be inserted into the brain at a defined depth of 1.8 mm. The injection needle was placed over the injection site and firmly inserted through the skull into the brain. The needle was held in place with the hemostat, and the opposite hand was used to quickly inject 10 μl of Fc-NEP or PBS. After 30 s, to allow for absorption, the needle was slowly removed. Immediately following injection, the animals were removed from anesthesia and placed in a warmed cage until they fully recovered. Any animal displaying seizures or lack of balance was immediately euthanized according to institutional animal welfare guidelines.

Detergent- and formic acid-soluble brain Aβ fractions were prepared as follows. Dissected brain hemispheres were sonicated in 15 volumes of PBS (137 mm NaCl, 2.7 mm KCl, 15 mm Na2HPO4*2H2O, 1.5 mm KH2PO4, pH 7.4) containing protease inhibitor cocktail (Roche Diagnostics). Triton X-100 was added to a final concentration of 1% and the homogenate was extracted on ice for 15 min, followed by centrifugation at 100,000 × g for 15 min. Supernatant was further diluted by adding an equal volume of ELISA assay buffer (50 mm Tris pH 7.5, 150 mm NaCl, 0.02% Tween 20, 3% BSA). These extracts were also used for measurement of brain Fc-NEP. Formic acid extracts were prepared by adding formic acid to the sonicated brain homogenate to a final concentration of 70% (v/v). Samples were placed on ice and vortexed every 5 min for 15 min, followed by neutralization with 1:20 (v/v) 1 m Tris base with protease inhibitor cocktail. The neutralized extract was centrifuged at 100,000 × g for 15 min and further diluted with the aforementioned ELISA assay buffer before use in assay.

Measurement of Aβ and Fc-NEP protein levels.

Mouse plasma and brain Aβ1–40 levels were measured by electrochemiluminescence assay as per the manufacturer's protocols (Meso Scale Discovery). The lower limits of quantitation for plasma and brain homogenate were ∼1 pg/ml and 0.2 pg Aβ/mg brain, respectively. Recombinant Fc-NEP levels in plasma and brain samples were measured by ELISA using an anti-NEP capture antibody (R&D Systems) and anti-mouse IgG detection antibody. Signal was developed using o-phenylenediamine dihydrochloride (Sigma) diluted in phosphate citrate buffer (Sigma) and read on a spectrophotometer at λEX = 450 nm.

Plaque histology.

Formalin-fixed brains were processed into paraffin and embedded for coronal sections. Serial sections (8 μm) were cut through the whole brain. Every tenth section was stained histochemically with H&E, Cresyl Violet, and Congo Red as per procedures taken from the Manual of Histologic Staining Methods of the Armed Forces Institute of Pathology (Blakiston). Every tenth section was also stained with the β-amyloid antibody 6E10 (Covance) at 1:50 dilution on the Discovery XT Immunostainer (Ventana Medical Systems/Roche). Preblocking was done with normal mouse serum (Jackson ImmunoResearch Laboratories) at 1:20 dilution. Endogenous biotin blocking was performed with the Endogenous Biotin Blocking Kit (Ventana Medical Systems). Additional blocking was done with the Ventana Antibody Block (Ventana Medical Systems). The Ventana MoMap Mouse on Mouse kit (Ventana Medical Systems) was used to label the primary antibody with biotin. The antibody was incubated for 6 h at room temperature. The signal was amplified using Ventana AmpMap Kit and then detected with DAB using the Ventana DABMap Kit (Ventana Medical Systems). Slides were coverslipped with permanent mounting media and scanned on a Hamamatsu Nanozoomer. Plaque sizes from 6E10 slides were quantified by Definiens software. Small plaques were defined as those from 23–69 μm in diameter, medium-sized plaques 69–230 μm in diameter, and large plaques >230 μm.

Quantitative PCR measurement of APP expression.

RNA was extracted from tissue using the RNeasy Mini Kit from Qiagen. TaqMan was performed using the Invitrogen Superscript III Platinum one-step quantitative RT-PCR system with a mouse APP primer/probe kit (Applied Biosystems) in the ABI 7900HT (Applied Biosystems).

Statistics and calculations.

In figures using box-and-whiskers plots, the boxes show the median with the box extending from the 25th to 75th percentiles, while the error bars extend to the highest and lowest values. The kinetic parameters kcat/Km were determined using the equation V = (kcat/Km)*E0*[S], when [S] ≪ Km, in Prism (GraphPad). Statistical significance was calculated using Student's t test. For experiments using wild-type mice, minimum detectable differences were calculated for pairwise comparisons of vehicle versus treatment groups (power, 80%; significance level, 0.05; two-sided), using NQuerey Advisor 7 software (Statistical Solutions). Effective doses and concentrations of Fc-NEP were calculated using the nonlinear regression sigmoidal dose–response (variable slope) equation in Prism (GraphPad Software). For pharmacokinetic determinations, male C57BL/6J mice (∼8 weeks old, 5 mice per dosing group) were dosed intravenously (i.v.) through the tail vein or intraperitoneally (i.p.) with 3.9 mg/kg (i.v.) or 13.5 mg/kg (i.p.) of Fc-NEP. Four to seven plasma samples were collected after i.v. or i.p. dosing, and the concentration of Fc-NEP was determined by activity assay and verified by electrochemiluminescence assay (Mesoscale). The plasma half-life of Fc-NEP was determined by noncompartmental regression analysis using the program WinNonLin (Pharsight Products).

Results

Recombinant Fc-NEP is active and degrades Aβ in vitro

NEP is an endogenous protease that degrades Aβ. The extracellular, catalytic domain of mouse NEP was expressed and purified as an Fc fusion protein as described in Materials and Methods. Fusing mouse IgG1 Fc to the N-terminal of NEP produces a fusion construct that resembles the orientation of the native NEP protein in membranes. To determine whether this soluble fusion protein retained proteolytic activity, we measured its catalytic efficiency against the chromogenic peptide substrate Abz-Ala-Gly-Leu-Ala-paranitroanaline, determining the kcat/Km to be 1.0 × 105 m−1 s−1. The same kcat/Km was measured for the extracellular domain of NEP lacking the Fc-fusion.

NEP has previously been reported to cleave Aβ peptides at several locations (Howell et al., 1995; Wang et al., 2006). To verify that the mouse Fc-NEP cleaved both mouse and human Aβ1–40 and Aβ1–42, the peptides were incubated with Fc-NEP and the disappearance of parent was monitored by multiple reaction monitoring mass spectrometry. As expected, both mouse and human Aβ peptides were degraded over time (Fig. 1). Similar results were obtained using electrochemiluminescent Aβ assay (data not shown), demonstrating no differences between direct measurement (mass spectrometry) and the secondary detection method relied upon in subsequent experiments.

Figure 1.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 1.

In vitro proteolysis of Aβ by Fc-NEP. Fc-NEP was incubated with Aβ peptides in buffer and proteolysis was followed by mass spectrometry. Mouse Aβ (A) and human Aβ (B) peptides were degraded over time as determined by loss of the parent peptide. Aβ1–40 is represented by ■, while Aβ1–42 is represented by ▴. Two ions were monitored by mass spectrometry to track Aβ peptides, the +5 and the +6.

To determine whether similar efficacy would occur under physiologically and therapeutically relevant conditions, Fc-NEP was spiked into plasma from wild-type mice that contained ∼70 pg/ml (16 pm) endogenous Aβ1–40, and degradation of the mouse Aβ was measured after 90 min. As shown in Figure 2, Fc-NEP degraded the mouse Aβ in a concentration-dependent manner, with maximum efficacy observed at [Fc-NEP] ≥ 50 nm. Similar results were observed when Fc-NEP was spiked into plasma from APP23 transgenic mice (data not shown) that produce human Aβ due to expression of human APP that contains the Swedish double mutation K670N/M671L (Sturchler-Pierrat et al. 1997). By comparison, when Tris buffer is used instead of plasma, a lower concentration of Fc-NEP (10 nm) clears >90% of a much higher concentration of mouse Aβ1–40 (100 nm) spiked into the Tris solution (data not shown). The apparent reduced efficiency of Fc-NEP degradation of Aβ in plasma relative to buffer might be caused by the presence of additional NEP substrates in plasma (Llorens-Cortes et al., 1992; Yamamoto et al., 1992; Pignone et al., 2007). Regardless, these in vitro results demonstrate the proteolytic efficacy of Fc-NEP against Aβ.

Figure 2.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 2.

In vitro proteolysis of plasma Aβ by Fc-NEP. Fc-NEP was added to wild-type mouse plasma and incubated at 37°C for 90 min, followed by measurement of endogenous mouse Aβ1–40 levels as described in Materials and Methods. Bars represent mean ± SD of two replicates.

Fc-NEP has a 10 day half-life in mouse

To determine whether the Fc-NEP would have a sufficient plasma half-life to enable in vivo studies of Aβ depletion, the pharmacokinetic parameters of the construct were measured following i.v. or i.p. administration of Fc-NEP to wild-type (WT) mice (Table 1). The half-life in mouse was 9–10 days, long enough for subsequent efficacy studies. Significantly, the primary method of detection was activity-based, meaning that the construct retained its proteolytic activity in vivo over time. Subsequent experiments use both a protein-based NEP ELISA as well as the activity assay to measure NEP concentrations. These two measurement assays were consistent with each other, confirming that the activity is durable and a good approximation of NEP protein levels.

View this table:
  • View inline
  • View popup
Table 1.

Fc-NEP pharmacokinetics in mouse

Peripheral Fc-NEP clears peripheral Aβ in vivo, but has no effect on brain Aβ

The in vivo objective was to completely degrade plasma Aβ and look for corresponding decreases in the detergent-extractable brain Aβ fraction, which would suggest a dynamic, nonsaturated equilibrium between the two pools. To determine whether Fc-NEP would reduce plasma Aβ, we first dosed WT mice with PBS or 55 mg/kg Fc-NEP i.v. and measured plasma Aβ1–40 24 and 96 h post-dose (data not shown). We found complete degradation of plasma Aβ1–40 in the NEP group at both time points compared to 74 ± 10 pg/ml Aβ1–40 in the PBS group (p < 0.01, N = 5/group). This corresponded to plasma Fc-NEP levels of 1800 ± 170 and 1270 ± 90 nm in the 24 and 96 h treatment groups, respectively. We attempted to measure Aβ1–42 levels in response to Fc-NEP treatment as well, but the endogenous concentrations in WT mice were below the limit of detection.

We next examined Fc-NEP concentration–response on plasma and brain Aβ1–40 levels at a 14 day time point, chosen to account for the possibility of lag time between plasma and brain Aβ reduction. As indicated in Figure 3, PBS or different doses of Fc-NEP were given at days 1 and 10, with plasma and brain measurements done at day 14. Dose-dependent clearance of plasma Aβ1–40 was observed (Fig. 3A), with Aβ concentrations decreasing from 72 ± 5 pg/ml in the PBS group to 42 ± 6, 34 ± 2, 10 ± 1, and 0 ± 0.2 pg/ml in the 0.55, 1.65, 5.5, and 55 mg/kg Fc-NEP treatment groups, respectively (p < 0.01 compared to PBS for all NEP groups). Plasma Fc-NEP concentrations were 16 ± 4, 100 ± 20, 390 ± 120, and 3170 ± 290 nm for each NEP-treated group from low to high dose (Fig. 3B). These values are consistent with the concentrations found in the prior pharmacokinetic experiment, considering that a second Fc-NEP dose was given here after one half-life. The ED50 and ED90 doses using this repeated dose schedule (days 1 and 10) were calculated to be 1.2 and 8.5 mg/kg, respectively, corresponding to plasma Fc-NEP concentrations of 67 and 630 nm. Detergent soluble brain Aβ1–40 was then extracted and measured as described in the Materials and Methods. Surprisingly, there was no corresponding decrease in this brain Aβ component at any dose when compared to PBS (Fig. 3C). For example, Aβ levels in the extract from PBS-treated mice were 1.4 ± 0.1 pg Aβ/mg brain, compared to 1.6 ± 0.1 pg/mg in the 55 mg/kg Fc-NEP treatment group. Interanimal variability (SEM) within each group was approximately ±10% and was consistent with brain Aβ measurements from other experiments. The minimum detectable differences that we would have been able to observe for each treatment group versus vehicle were calculated to be as follows: 0.55 mg/kg = 42.5%; 1.65 mg/kg = 42.5%; 5.5 mg/kg = 39.1%; 55 mg/kg = 39.1% as described in Materials and Methods.

Figure 3.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 3.

In vivo clearance of Aβ by peripheral Fc-NEP. PBS or the indicated doses of Fc-NEP were administered to WT mice i.v. at days 1 and 10. Aβ and NEP levels were measured at day 14 as described in the Materials and Methods. A, Plasma Aβ1–40 was found to be cleared in a dose-dependent manner, with complete clearance observed at the highest dose. N = 8/group and the asterisk (*) indicates p < 0.01 compared to PBS. B, Plasma Fc-NEP levels were determined by NEP ELISA and confirmed by activity assay. NEP was not found in the PBS group (not shown). N = 4/group. C, Triton X-100 soluble brain Aβ1–40 was extracted and measured. No decrease was found upon Fc-NEP treatment compared to PBS-treated animals. N = 8/group.

To determine whether the apparent increase in brain Aβ in the 1.65 mg/kg Fc-NEP-treated group (Fig. 3C) was due to Fc-NEP entry into the brain and binding/sequestration to brain Aβ, we looked for evidence of Fc-NEP in the brain. A mouse NEP ELISA was performed on the detergent-soluble brain fraction. No exogenous Fc-NEP was found in samples from this dose group above the 10 pm limit of detection of the assays (data not shown).

To determine whether a longer treatment duration would result in an associated decrease in brain Aβ levels, a time course study was run in which mice were administered 10 mg/kg Fc-NEP (slightly above the ED90 dose as determined by plasma Aβ clearance) every 10 days, and plasma and brain Aβ1–40 levels were measured at days 14, 28, and 35. Despite achieving the expected >90% clearance of plasma Aβ compared to PBS control at each time point (p < 0.01, N ≥ 8), there again was no observed decrease in detergent soluble brain Aβ1–40 (Fig. 4). The Aβ1–40 levels were consistently around 1.5 pg/mg brain, with standard error around 10%. The minimum detectable difference for each treatment group versus its time-matched PBS control was: 14 days, 21.8%; 28 days, 32.0%; 35 days, 10.9%. Plasma Fc-NEP concentrations at the 14, 28, and 35 day time points were 2250, 2370, and 2830 nm, respectively.

Figure 4.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 4.

Brain Aβ is not cleared over 35 days with repeated dosing. PBS or Fc-NEP (10 mg/kg) was administered i.v. to WT mice every 10 days. At days 14, 28, and 35, Triton X-100 soluble brain Aβ was extracted and measured as described in Materials and Methods. N ≥ 8/group.

To determine whether Aβ production might be upregulated in response to chronic exposure to the Fc-NEP construct and is thus masking Aβ clearance in the brain, we looked at APP mRNA levels in the brain from the 14 day time point of WT mice dosed with 10 mg/kg Fc-NEP or PBS. No difference in APP expression was found between groups (n = 10/group) however, suggesting that there is not compensatory upregulation of gene expression occurring.

Although our results in WT mice suggested a lack of soluble brain Aβ reduction in response to increased peripheral Aβ clearance, we wanted to determine whether there would be an effect on established amyloid plaques in the brain. Therefore, Fc-NEP was tested in APP23 mice, which develop amyloid plaques in the brain as they age due to the production of human Aβ. Seventeen-month-old APP23 mice with high plaque burdens were administered 100 mg/kg Fc-NEP (ED90 dose as determined by plasma Aβ levels) i.v. every 12–16 days for 3 months. At the end of the study, soluble plasma and cerebrospinal fluid levels of the human Aβ produced by the transgene were measured. Amyloid plaque loads were quantified by measuring Aβ in formic acid-extracted brain samples as well as through brain histology. As shown in Figure 5, no decreases in total brain Aβ or CSF Aβ were observed despite complete degradation of plasma Aβ. Similarly, no significant differences in numbers of large plaques (161 vs 171 for NEP vs PBS), medium plaques (179 vs 178 for NEP vs PBS), or small plaques (284 vs 277 for NEP vs PBS) were found. Fc-NEP levels in the brain at the end of the study were <1 nm. These data are consistent with our soluble brain Aβ results in WT mice.

Figure 5.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 5.

Chronic peripheral dosing of Fc-NEP does not lower brain Aβ1–40 in plaque-bearing APP23 mice despite complete peripheral depletion. PBS or Fc-NEP (100 mg/kg) was administered i.v. to 17 month old APP23 mice every 2 weeks for 3 months. A, Plasma levels of the transgene-expressed human Aβ were measured at the end of the study (p < 0.001, N ≥ 10/group). B, Formic acid was used to extract soluble and insoluble brain Aβ (N ≥ 10/group). C, CSF was extracted and Aβ levels measured (N ≥ 13/group). Outliers greater than 3 × SEM were removed from the analyses.

Intracranial injection of Fc-NEP acutely reduces soluble brain Aβ

To verify that directly augmenting brain amyloid clearance capacity would result in decreased levels of soluble brain Aβ, 0.5 nmol Fc-NEP was administered through intracranial injection to the brains of WT mice. Compared to a PBS control injection, detergent soluble brain Aβ levels were decreased 46% (p = 0.04) at 1 h postinjection, but returned to normal between 6–24 h (Fig. 6). Fc-NEP levels in the brain were found to be 16, 60, and 140 nm in the 3 animals from the 1 h time point, but were 11 nm or less at the later time points.

Figure 6.
  • Download figure
  • Open in new tab
  • Download powerpoint
Figure 6.

Intracranial delivery of Fc-NEP reduces brain Aβ1–40 immediately following treatment. PBS or Fc-NEP (6 mg/ml, 0.5 nmol) were administered to WT mice in 10 μl solution. NEP-treated samples were taken at 1, 6, and 24 h, and PBS samples were taken at 6 h. Triton X-100 soluble brain Aβ was extracted and measured as described in Materials and Methods. N = 3/group. Asterisk (*) indicates p = 0.04 compared to the PBS group.

Discussion

The key findings of this study are as follows. First, we have fused the extracellular catalytic domain of neprilysin with a mouse IgG1 Fc region, resulting in a constitutively active protease that retains activity against Aβ peptides. This protein has a long half-life characteristic of antibodies, enabling its use in vivo. Second, we have used this Fc-NEP protease to degrade, rather than sequester, plasma Aβ in mice, finding brain Aβ levels unchanged in response. This suggests that the brain-to-plasma clearance mechanisms for Aβ are saturated under normal conditions and that an additional driving force in the form of reduced plasma Aβ concentrations cannot enhance clearance from brain. Third, we have determined that brain APP expression does not change in response to reduction of peripheral Aβ concentrations, suggesting that the rate of Aβ production is not tied to changes in plasma Aβ. Fourth, we demonstrated that by directly enhancing degradation mechanisms in the brain, levels of brain Aβ could be lowered, although this clearance is rapidly overcome by the robust production of Aβ.

Plasma Aβ was degraded by Fc-NEP in a concentration-dependent manner. The higher activity requirements for Aβ reduction in plasma compared to buffer might be due to the presence of additional NEP substrates, such as atrial natriuretic peptide, in plasma (Llorens-Cortes et al., 1992; Yamamoto et al., 1992; Pignone et al., 2007). The EC90 in vivo was 632 nm, compared to ∼50 nm in vitro. This likely reflects the rapid peripheral turnover of Aβ and other endogenous NEP substrates, many of which have reported half-lives of only minutes (Yandle et al., 1986; Grouzmann et al., 2001). Nonetheless, our data suggest it was possible to achieve Fc-NEP concentrations in vivo sufficient to maintain animals in a plasma–Aβ1–40 deficient state, thus allowing investigations into the efflux of brain Aβ to the periphery. It should be noted that proteolytic fragments were not tracked in vivo, and thus it remains possible that shorter Aβ isoforms may have been transiently generated during degradation. The MRM analysis of Aβ degradation by Fc-NEP in buffer tracked the disappearance of two internal peptides in the Aβ sequence, suggesting that further amyloidogenic species are not generated by Fc-NEP activity. However, because the further clearance of such peptide fragments was not followed in vivo, it is unknown whether they influenced Aβ transport/diffusion between compartments.

Surprisingly, soluble brain Aβ1–40 levels did not decrease despite the complete degradation of plasma Aβ1–40. Although we found an apparent increase in brain Aβ levels in the 1.65 mg/kg treatment group at the 14 day time point (Fig. 3B), similar findings were not made at different doses or time points. The lack of evidence for Fc-NEP in the brain or upregulation of APP expression in response to treatment suggests that the upregulation in this single group might be due to variability in extracting and measuring soluble Aβ pools at concentrations near the lower limits of quantitation for the assays. Our studies analyzed brain homogenate, which is comprised predominantly of cellular Aβ, and thus more subtle alterations in brain interstitial fluid could have been masked, particularly with regard to the 40% minimum detectable difference (MDD) in our acute wild-type mouse studies. With this in mind, we ran longer duration studies to enhance the likelihood of detecting smaller accumulated alterations in brain Aβ levels from such sources. Still, despite a reduction in the MDD to 11% in the 35 day study, no significant reductions in brain Aβ were detected. It is also possible that decreases in extracellular brain Aβ occur, but are masked by decreased cellular degradation of intracellular Aβ followed by equilibration of the pools, since our extraction method does not discern between the two pools. Unfortunately, examination of such cellular trafficking was outside the scope of our studies.

Aβ concentrations in the peripheral and central compartments are influenced by efflux and influx mechanisms. A number of laboratories have reported transport of Aβ from the periphery into the brain (Zlokovic et al., 1993; Ghilardi et al., 1996; Poduslo et al., 1997; Mackic et al., 1998) and in the reverse direction, from the brain into the periphery (Ghersi-Egea et al., 1996; Shibata et al., 2000; Cirrito et al., 2005). Movement of Aβ in either direction is dependent on the integrity of the neurovascular unit and is mediated by a number of binding partners and transporter systems, such as LRP-1, RAGE, ApoE, ApoJ, and P-glycoprotein, which are regulated in a complex fashion (for review, see Sagare et al., 2012). The failure to observe decreases in brain Aβ suggests that the basal efflux rate is already at its maximum. Likewise, no Fc-NEP was found in the brain compartment, consistent with an intact blood–brain barrier, BBB, in these healthy WT mice preventing the influx of the exogenous protein. Interestingly, it has previously been reported (Banks et al., 2003; Pascale et al., 2011) that the Aβ efflux capacity decreases further with age, and so improved efficacy of a truly peripherally acting anti-Aβ therapeutic would not be expected in older animals. Consistent with this, we did not observe decreased total amyloid load or plaque numbers in very old APP23 mice treated for 3 months with Fc-NEP. Although it may be argued that the plaque burden might have been too high to see an effect in the aged APP23 mice used in the present study, it should be noted that some of the original experiments presented in support of the sink hypothesis were performed in older, plaque-burdened APP transgenic mice (DeMattos et al., 2002), and that efficacy of either passive or active immunization in reducing amyloid burden in aged transgenic mice has been repeatedly demonstrated, particularly in models that deposit predominantly diffuse amyloid (for review, see Golde et al., 2009). In such models, reduced amyloid burden has been most sensitively detected by immunohistochemical quantification of small and/or diffuse deposits in comparison to biochemical analysis, as exemplified by passive and active immunization studies with APP23 mice of similar or greater age than those used in the present study (Pfeifer et al., 2002; Wiessner et al., 2011). However, no such effect was detected in histological quantifications in the present study. Our data with NEP suggest that the peripheral immunotherapies, which essentially clear free plasma Aβ by sequestering it as part of an antibody complex, could be exerting their effects on the brain through a mechanism other than a peripheral sink. Instead, they may be crossing the BBB and acting directly in the brain. Indeed, it has been shown that the BBB becomes more permeable in aged transgenic mice overexpressing human Aβ (Paul et al., 2007), as well as in a fraction of the clinical AD population (Bowman et al., 2007). Although levels of such antibodies in the brain have been shown to be very low (Levites et al., 2006), these antibodies might be activating a glial response that leads to increased amyloid clearance by macrophage phagocytosis (Wang et al., 2011). This would be consistent with our results in the aged APP23 mice in which very low levels of Fc-NEP were found in the brain but were not sufficient to directly lower brain Aβ levels by proteolysis.

Finally, the scope of our studies did not include monitoring levels of soluble Aβ oligomers in the brain. These multimeric species have been implicated in recent years as contributing to the pathogenesis of AD (Shankar et al., 2008). It is not known whether NEP would have a direct proteolytic effect on these oligomers, or whether reduction of the peripheral Aβ pool would subsequently reduce their concentration in the brain. However, this outcome seems unlikely in the absence of corresponding changes in either the soluble monomeric brain Aβ pool or the overall amyloid plaque burden.

Aβ-neutralizing approaches have been a major focus of AD research, despite questions about the mechanisms of action preclinically and clinically. Results from studies of these approaches have been inconsistent, both in rodent and in man. Peripherally acting therapeutics are attractive because they simplify administration and control of exposure and offer the use of plasma Aβ as a surrogate biomarker of efficacy. However, our results, combined with a growing body of literature (Golde et al., 2009), suggest that it might not be possible to increase brain Aβ efflux sufficiently to achieve therapeutic benefit. We have found no evidence for the existence of a robust dynamic equilibrium between plasma and brain Aβ pools that could be exploited for therapeutic benefit. Indeed, the robust return of brain Aβ levels to normal following direct proteolysis by intracranial NEP further demonstrates the challenge of focusing on Aβ clearance and suggests that targeting Aβ production will also be important. Efficacy of this type of bimodal strategy was recently suggested by studies in which Aβ production was impaired in conjunction with anti-amyloid immunotherapy (Wang et al., 2011). This needs to be considered for the future development of Aβ-directed therapeutics, since it will likely affect the pharmacokinetic/pharmacodynamic relationship of any such drugs in man.

Footnotes

  • We thank Dr. Matthias Staufenbiel for guidance with the amyloid extraction and quantification protocols and Lacey Kischassey and Evelyn Rodrigo for technical assistance.

  • Correspondence should be addressed to Dr. Andrew M. Schumacher, Genomics Institute of the Novartis Research Foundation, 10675 John Jay Hopkins Drive, San Diego, CA 92121. aschumacher{at}gnf.org

References

  1. ↵
    1. Banks WA,
    2. Robinson SM,
    3. Verma S,
    4. Morley JE
    (2003) Efflux of human and mouse amyloid β proteins 1–40 and 1–42 from brain: impairment in a mouse model of Alzheimer's Disease. Neuroscience 121:487–492.
    OpenUrlCrossRefPubMed
  2. ↵
    1. Bowman GL,
    2. Kaye JA,
    3. Moore M,
    4. Waichunas D,
    5. Carlson NE,
    6. Quinn JF
    (2007) Blood-brain barrier impairment in Alzheimer disease: stability and functional significance. Neurology 68:1809–1814.
    OpenUrlAbstract/FREE Full Text
  3. ↵
    1. Cirrito JR,
    2. Deane R,
    3. Fagan AM,
    4. Spinner ML,
    5. Parsadanian M,
    6. Finn MB,
    7. Jiang H,
    8. Prior JL,
    9. Sagare A,
    10. Bales KR,
    11. Paul SM,
    12. Zlokovic BV,
    13. Piwnica-Worms D,
    14. Holtzman DM
    (2005) P-glycoprotein deficiency at the blood-brain barrier increases amyloid-beta deposition in an Alzheimer disease mouse model. J Clin Invest 115:3285–3290.
    OpenUrlCrossRefPubMed
  4. ↵
    1. DeMattos RB,
    2. Bales KR,
    3. Cummins DJ,
    4. Dodart JC,
    5. Paul SM,
    6. Holtzman DM
    (2001) Peripheral anti-Aβ antibody alters CNS and plasma Aβ clearance and decreases brain Aβ burden in a mouse model of Alzheimer's disease. Proc Natl Acad Sci U S A 98:8850–8855.
    OpenUrlAbstract/FREE Full Text
  5. ↵
    1. DeMattos RB,
    2. Bales KR,
    3. Cummins DJ,
    4. Paul SM,
    5. Holtzman DM
    (2002) Brain to plasma amyloid-β efflux: a measure of brain amyloid burden in a mouse model of Alzheimer's disease. Science 295:2264–2267.
    OpenUrlAbstract/FREE Full Text
  6. ↵
    1. Ghersi-Egea JF,
    2. Gorevic PD,
    3. Ghiso J,
    4. Frangione B,
    5. Patlak CS,
    6. Fenstermacher JD
    (1996) Fate of cerebrospinal fluid-borne amyloid beta-peptide: rapid clearance into blood and appreciable accumulation by cerebral arteries. J Neurochem 67:880–883, doi:10.1046/j.1471-4159.1996.67020880.x, medline:8764620.
    OpenUrlCrossRefPubMed
  7. ↵
    1. Ghilardi JR,
    2. Catton M,
    3. Stimson ER,
    4. Rogers S,
    5. Walker LC,
    6. Maggio JE,
    7. Mantyh PW
    (1996) Intra-arterial infusion of [125I]Abeta 1–40 labels amyloid deposits in the aged primate brain in vivo. Neuroreport 7:2607–2611, doi:10.1097/00001756-199611040-00040, medline:8981432.
    OpenUrlCrossRefPubMed
  8. ↵
    1. Golde TE,
    2. Das P,
    3. Levites Y
    (2009) Quantitative and mechanistic studies of Aβ immunotherapy. CNS Neurol Disord Drug Targets 8:31–49.
    OpenUrlCrossRefPubMed
  9. ↵
    1. Grouzmann E,
    2. Fathi M,
    3. Gillet M,
    4. de Torrenté A,
    5. Cavadas C,
    6. Brunner H,
    7. Buclin T
    (2001) Disappearance rate of catecholamines, total metanephrines, and neuropeptide Y from the plasma of patients after resection of pheochromocytoma. Clin Chem 47:1075–1082.
    OpenUrlAbstract/FREE Full Text
  10. ↵
    1. Hardy J,
    2. Selkoe DJ
    (2002) The amyloid hypothesis of Alzheimer's disease: progress and problems on the road to therapeutics. Science 297:253–256.
    OpenUrlAbstract/FREE Full Text
  11. ↵
    1. Howell S,
    2. Nalbantoglu J,
    3. Crine P
    (1995) Neutral endopeptidase can hydrolyze beta-amyloid(1–40) but shows no effect on beta-amyloid precursor protein metabolism. Peptides 16:647–652.
    OpenUrlCrossRefPubMed
  12. ↵
    1. Iwata N,
    2. Tsubuki S,
    3. Takaki Y,
    4. Watanabe K,
    5. Sekiguchi M,
    6. Hosoki E,
    7. Kawashima-Morishima M,
    8. Lee HJ,
    9. Hama E,
    10. Sekine-Aizaway Y,
    11. Saido TC
    (2000) Identification of the major Aβ1–42-degrading catabolic pathway in brain parenchyma: suppression leads to biochemical and pathological deposition. Nat Med 6:143–150.
    OpenUrlCrossRefPubMed
  13. ↵
    1. Iwata N,
    2. Tsubuki S,
    3. Takaki Y,
    4. Shirotani K,
    5. Lu B,
    6. Gerard NP,
    7. Gerard C,
    8. Hama E,
    9. Lee HJ,
    10. Saido TC
    (2001) Metabolic regulation of brain Aβ by neprilysin. Science 292:1550–1552.
    OpenUrlAbstract/FREE Full Text
  14. ↵
    1. Jankowsky JL,
    2. Younkin LH,
    3. Gonzales V,
    4. Fadale DJ,
    5. Slunt HH,
    6. Lester HA,
    7. Younkin SG,
    8. Borchelt DR
    (2007) Rodent Aβ modulates the solubility and distribution of amyloid deposits in transgenic mice. J Biol Chem 282:22707–22720.
    OpenUrlAbstract/FREE Full Text
  15. ↵
    1. Levites Y,
    2. Smithson LA,
    3. Price RW,
    4. Dakin RS,
    5. Yuan B,
    6. Sierks MR,
    7. Kim J,
    8. McGowan E,
    9. Reed DK,
    10. Rosenberry TL,
    11. Das P,
    12. Golde TE
    (2006) Insights into the mechanisms of action of anti-Abeta antibodies in Alzheimer's disease mouse models. FASEB J 20:2576–2578.
    OpenUrlAbstract/FREE Full Text
  16. ↵
    1. Licklider LJ,
    2. Thoreen CC,
    3. Peng J,
    4. Gygi SP
    (2002) Automation of nanoscale microcapillary liquid chromatography-tandem mass spectrometry with a vented column. Anal Chem 74:3076–3083, doi:10.1021/ac025529o, medline:12141667.
    OpenUrlCrossRefPubMed
  17. ↵
    1. Llorens-Cortes C,
    2. Huang H,
    3. Vicart P,
    4. Gasc JM,
    5. Paulin D,
    6. Corvol P
    (1992) Identification and characterization of neutral endopeptidase in endothelial cell from venous and arterial origin. J Biol Chem 267:14012–14018.
    OpenUrlAbstract/FREE Full Text
  18. ↵
    1. Mackic JB,
    2. Weiss MH,
    3. Miao W,
    4. Kirkman E,
    5. Ghiso J,
    6. Calero M,
    7. Bading J,
    8. Frangione B,
    9. Zlokovic BV
    (1998) Cerebrovascular accumulation and increased blood-brain barrier permeability to circulating Alzheimer's amyloid beta peptide in aged squirrel monkey with cerebral amyloid angiopathy. J Neurochem 70:210–215.
    OpenUrlPubMed
  19. ↵
    1. Marques MA,
    2. Kulstada JJ,
    3. Savard CE,
    4. Green PS,
    5. Lee SP,
    6. Craft S,
    7. Watson GS,
    8. Cook DG
    (2009) Peripheral amyloid-β levels regulate amyloid-β clearance from the central nervous system. J Alzheimers Dis 16:325–329, doi:10.3233/JAD-2009-0964, medline:19221422.
    OpenUrlCrossRefPubMed
  20. ↵
    1. Marr RA,
    2. Rockenstein E,
    3. Mukherjee A,
    4. Kindy MS,
    5. Hersh LB,
    6. Gage FH,
    7. Verma IM,
    8. Masliah E
    (2003) Neprilysin gene transfer reduces human amyloid pathology in transgenic mice. J Neurosci 23:1992–1996.
    OpenUrlAbstract/FREE Full Text
  21. ↵
    1. Masters CL,
    2. Simms G,
    3. Weinman NA,
    4. Multhaup G,
    5. McDonald BL,
    6. Beyreuther K
    (1985) Amyloid plaque core protein in Alzheimer disease and Down syndrome. Proc Natl Acad Sci U S A 82:4245–4249.
    OpenUrlAbstract/FREE Full Text
  22. ↵
    1. Pascale CL,
    2. Miller MC,
    3. Chiu C,
    4. Boylan M,
    5. Caralopoulos IN,
    6. Gonzalez L,
    7. Johanson CE,
    8. Silverberg GD
    (2011) Amyloid-beta transporter expression at the blood-CSF barrier is age-dependent. Fluids Barriers CNS 8:21–31.
    OpenUrlCrossRefPubMed
  23. ↵
    1. Paul J,
    2. Strickland S,
    3. Melchor JP
    (2007) Fibrin deposition accelerates neurovascular damage and neuroinflammation in mouse models of Alzheimer's disease. J Exp Med 204:1999–2008.
    OpenUrlAbstract/FREE Full Text
  24. ↵
    1. Pfeifer M,
    2. Boncristiano S,
    3. Bondolfi L,
    4. Stalder A,
    5. Deller T,
    6. Staufenbiel M,
    7. Mathews PM,
    8. Jucker M
    (2002) Cerebral hemorrhage after passive anti-Aβ immunotherapy. Science 298:1379.
    OpenUrlFREE Full Text
  25. ↵
    1. Pignone A,
    2. Del Rosso AD,
    3. Brosnihan KB,
    4. Perfetto F,
    5. Livi R,
    6. Fiori G,
    7. Guiducci S,
    8. Cinelli M,
    9. Rogai V,
    10. Tempestini A,
    11. Bartoli F,
    12. Generini S,
    13. Ferrario CM,
    14. Cerinic MM
    (2007) Reduced circulating levels of angiotensin-(1–7) in systemic sclerosis: a new pathway in the dysregulation of endothelial-dependent vascular tone control. Ann Rheum Dis 66:1305–1310.
    OpenUrlAbstract/FREE Full Text
  26. ↵
    1. Poduslo JF,
    2. Curran GL,
    3. Haggard JJ,
    4. Biere AL,
    5. Selkoe DJ
    (1997) Permeability and residual plasma volume of human, Dutch variant, and rat amyloid beta-protein 1–40 at the blood-brain barrier. Neurobiol Dis 4:27–34.
    OpenUrlCrossRefPubMed
  27. ↵
    1. Sagare AP,
    2. Bell RD,
    3. Zlokovic BV
    (2012) Neurovascular dysfunction and faulty amyloid β-peptide clearance in Alzheimer disease. Cold Spring Harb Perspect Med 2:a011452.
    OpenUrlAbstract/FREE Full Text
  28. ↵
    1. Saito T,
    2. Iwata N,
    3. Tsubuki S,
    4. Takaki Y,
    5. Takano J,
    6. Huang SM,
    7. Suemoto T,
    8. Higuchi M,
    9. Saido TC
    (2005) Somatostatin regulates brain amyloid β peptide Aβ42 through modulation of proteolytic degradation. Nat Med 11:434–439.
    OpenUrlCrossRefPubMed
  29. ↵
    1. Schlaeger EJ,
    2. Christensen K
    (1999) Transient gene expression in mammalian cells grown in serum-free suspension culture. Cytotechnology 30:71–83.
    OpenUrlCrossRefPubMed
  30. ↵
    1. Shankar GM,
    2. Li S,
    3. Mehta TH,
    4. Garcia-Munoz A,
    5. Shepardson NE,
    6. Smith I,
    7. Brett FM,
    8. Farrell MA,
    9. Rowan MJ,
    10. Lemere CA,
    11. Regan CM,
    12. Walsh DM,
    13. Sabatini BL,
    14. Selkoe DJ
    (2008) Amyloid-beta protein dimers isolated directly from Alzheimer's brains impair synaptic plasticity and memory. Nat Med 14:837–842.
    OpenUrlCrossRefPubMed
  31. ↵
    1. Shibata M,
    2. Yamada S,
    3. Kumar SR,
    4. Calero M,
    5. Bading J,
    6. Frangione B,
    7. Holtzman DM,
    8. Miller CA,
    9. Strickland DK,
    10. Ghiso J,
    11. Zlokovic BV
    (2000) Clearance of Alzheimer's amyloid-b1–40 peptide from brain by LDL receptor–related protein-1 at the blood-brain barrier. J Clin Invest 106:1489–1499, doi:10.1172/JCI10498, medline:11120756.
    OpenUrlCrossRefPubMed
  32. ↵
    1. Sturchler-Pierrat C,
    2. Abramowski D,
    3. Duke M,
    4. Wiederhold KH,
    5. Mistl C,
    6. Rothacher S,
    7. Ledermann B,
    8. Bürki K,
    9. Frey P,
    10. Paganetti PA,
    11. Waridel C,
    12. Calhoun ME,
    13. Jucker M,
    14. Probst A,
    15. Staufenbiel M,
    16. Sommer B
    (1997) Two amyloid precursor protein transgenic mouse models with Alzheimer disease-like pathology. Proc Natl Acad Sci U S A 94:13287–13292.
    OpenUrlAbstract/FREE Full Text
  33. ↵
    1. Wang A,
    2. Das P,
    3. Switzer RC 3rd.,
    4. Golde TE,
    5. Jankowsky JL
    (2011) Robust amyloid clearance in a mouse model of Alzheimer's Disease provides novel insights into the mechanism of amyloid-β immunotherapy. J Neurosci 31:4124–4136.
    OpenUrlAbstract/FREE Full Text
  34. ↵
    1. Wang DS,
    2. Dickson DW,
    3. Malter JS
    (2006) β-Amyloid degradation and Alzheimer's disease. J Biomed Biotech 2006:1–12.
    OpenUrl
  35. ↵
    1. Wiessner C,
    2. Wiederhold KH,
    3. Tissot AC,
    4. Frey P,
    5. Danner S,
    6. Jacobson LH,
    7. Jennings GT,
    8. Lüönd R,
    9. Ortmann R,
    10. Reichwald J,
    11. Zurini M,
    12. Mir A,
    13. Bachmann MF,
    14. Staufenbiel M
    (2011) The second-generation active Abeta immunotherapy CAD106 reduces amyloid accumulation in APP transgenic mice while minimizing potential side effects. J Neurosci 31:9323–9331.
    OpenUrlAbstract/FREE Full Text
  36. ↵
    1. Yamamoto K,
    2. Chappell K,
    3. Brosnihan KB,
    4. Ferrario CM
    (1992) In vivo metabolism of angiotensin I by neutral endopeptidase (EC3.4.24.11) in spontaneously hypertensive rats. Hypertension 19:1201–1211.
    OpenUrl
  37. ↵
    1. Yandle TG,
    2. Richards AM,
    3. Nicholls MG,
    4. Cuneo R,
    5. Espiner EA,
    6. Livesey JH
    (1986) Metabolic clearance rate and plasma half life of alpha-human atrial natriuretic peptide in man. Life Sci 38:1827–1833.
    OpenUrlCrossRefPubMed
  38. ↵
    1. Zlokovic BV
    (2004) Clearing amyloid through the blood–brain barrier. J Neurochem 89:807–811.
    OpenUrlCrossRefPubMed
  39. ↵
    1. Zlokovic BV,
    2. Ghiso J,
    3. Mackic JB,
    4. McComb JG,
    5. Weiss MH,
    6. Frangione B
    (1993) Blood-brain barrier transport of circulating Alzheimer's amyloid beta. Biochem Biophys Res Com 197:1034–1040.
    OpenUrlCrossRefPubMed
  40. ↵
    1. Zou LB,
    2. Mouri A,
    3. Iwata N,
    4. Saido TC,
    5. Wang D,
    6. Wang MW,
    7. Mizoguchi H,
    8. Noda Y,
    9. Nabeshima T
    (2006) Inhibition of neprilysin by infusion of thiorphan into the hippocampus causes an accumulation of amyloid β and impairment of learning and memory. J Pharm Exp Ther 317:334–340.
    OpenUrlAbstract/FREE Full Text
Back to top

In this issue

The Journal of Neuroscience: 33 (6)
Journal of Neuroscience
Vol. 33, Issue 6
6 Feb 2013
  • Table of Contents
  • Table of Contents (PDF)
  • About the Cover
  • Index by author
  • Advertising (PDF)
  • Ed Board (PDF)
Email

Thank you for sharing this Journal of Neuroscience article.

NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.

Enter multiple addresses on separate lines or separate them with commas.
Enhanced Proteolytic Clearance of Plasma Aβ by Peripherally Administered Neprilysin Does Not Result in Reduced Levels of Brain Aβ in Mice
(Your Name) has forwarded a page to you from Journal of Neuroscience
(Your Name) thought you would be interested in this article in Journal of Neuroscience.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.
Print
View Full Page PDF
Citation Tools
Enhanced Proteolytic Clearance of Plasma Aβ by Peripherally Administered Neprilysin Does Not Result in Reduced Levels of Brain Aβ in Mice
John R. Walker, Reynand Pacoma, James Watson, Weijia Ou, Juliano Alves, Daniel E. Mason, Eric C. Peters, Hugo D. Urbina, Gus Welzel, Alana Althage, Bo Liu, Tove Tuntland, Laura H. Jacobson, Jennifer L. Harris, Andrew M. Schumacher
Journal of Neuroscience 6 February 2013, 33 (6) 2457-2464; DOI: 10.1523/JNEUROSCI.3407-12.2013

Citation Manager Formats

  • BibTeX
  • Bookends
  • EasyBib
  • EndNote (tagged)
  • EndNote 8 (xml)
  • Medlars
  • Mendeley
  • Papers
  • RefWorks Tagged
  • Ref Manager
  • RIS
  • Zotero
Respond to this article
Request Permissions
Share
Enhanced Proteolytic Clearance of Plasma Aβ by Peripherally Administered Neprilysin Does Not Result in Reduced Levels of Brain Aβ in Mice
John R. Walker, Reynand Pacoma, James Watson, Weijia Ou, Juliano Alves, Daniel E. Mason, Eric C. Peters, Hugo D. Urbina, Gus Welzel, Alana Althage, Bo Liu, Tove Tuntland, Laura H. Jacobson, Jennifer L. Harris, Andrew M. Schumacher
Journal of Neuroscience 6 February 2013, 33 (6) 2457-2464; DOI: 10.1523/JNEUROSCI.3407-12.2013
del.icio.us logo Digg logo Reddit logo Twitter logo CiteULike logo Facebook logo Google logo Mendeley logo
  • Tweet Widget
  • Facebook Like
  • Google Plus One

Jump to section

  • Article
    • Abstract
    • Introduction
    • Materials and Methods
    • Results
    • Discussion
    • Footnotes
    • References
  • Figures & Data
  • Info & Metrics
  • eLetters
  • PDF

Responses to this article

Respond to this article

Jump to comment:

No eLetters have been published for this article.

Related Articles

Cited By...

More in this TOC Section

Articles

  • Choice Behavior Guided by Learned, But Not Innate, Taste Aversion Recruits the Orbitofrontal Cortex
  • Maturation of Spontaneous Firing Properties after Hearing Onset in Rat Auditory Nerve Fibers: Spontaneous Rates, Refractoriness, and Interfiber Correlations
  • Insulin Treatment Prevents Neuroinflammation and Neuronal Injury with Restored Neurobehavioral Function in Models of HIV/AIDS Neurodegeneration
Show more Articles

Neurobiology of Disease

  • Lumateperone Normalizes Pathological Levels of Acute Inflammation through Important Pathways Known to Be Involved in Mood Regulation
  • Prolactin-Releasing Peptide Contributes to Stress-Related Mood Disorders and Inhibits Sleep/Mood Regulatory Melanin-Concentrating Hormone Neurons in Rats
  • mTORC2 Inhibition Improves Morphological Effects of PTEN Loss, But Does Not Correct Synaptic Dysfunction or Prevent Seizures
Show more Neurobiology of Disease
  • Home
  • Alerts
  • Visit Society for Neuroscience on Facebook
  • Follow Society for Neuroscience on Twitter
  • Follow Society for Neuroscience on LinkedIn
  • Visit Society for Neuroscience on Youtube
  • Follow our RSS feeds

Content

  • Early Release
  • Current Issue
  • Issue Archive
  • Collections

Information

  • For Authors
  • For Advertisers
  • For the Media
  • For Subscribers

About

  • About the Journal
  • Editorial Board
  • Privacy Policy
  • Contact
(JNeurosci logo)
(SfN logo)

Copyright © 2023 by the Society for Neuroscience.
JNeurosci Online ISSN: 1529-2401

The ideas and opinions expressed in JNeurosci do not necessarily reflect those of SfN or the JNeurosci Editorial Board. Publication of an advertisement or other product mention in JNeurosci should not be construed as an endorsement of the manufacturer’s claims. SfN does not assume any responsibility for any injury and/or damage to persons or property arising from or related to any use of any material contained in JNeurosci.