Table 1.

Summary of Hu coding region alternate splice variants

VariantSequence
HuA
 sv4QRFR---------------------------FSP
HuB
 sv2AQRFRLDNLLNMAYGVKR--------------FSP
 sv2BQRFRLDNLLNMAYGVKR--------------FSP
 sv4QRFR---------------------------FSP
HuC
 sv1QRFRLDNLLNMAYGVKS-------PLSLIARFSP
 sv2QRFRLDNLLNMAYGVKR--------------FSP
 sv3QRFR--------------------PLSLIARFSP
 sv4QRFR---------------------------FSP
HuD
 sv1QRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSP
 sv2QRFRLDNLLNMAYGVKR--------------FSP
 sv4QRFR---------------------------FSP
  • Splice variants 1–4 from the spacer region between RRM 2 and RRM 3 (as illustrated in Fig. 2A) are shown. Variants from each gene are named on the left, and sequences are shown in single-letter amino acid code, with gaps as hyphens. Alternate splice junctions were confirmed by cloning and sequencing mouse genomic clones (data not shown).